SecReT6
Protein ID: 66048181
SecReT6 ID86
T6SS typei4b
Gene symbol-
Locus tagPsyr_4957
StrainPseudomonas syringae pv. syringae B728a
Repliconchromosome [GenBank: NC_007005] [Browse all T6SS(s) in this replicon]
Location [Strand]5875673..5876743 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ4ZLI8
KEGG IDpsb:Psyr_4957
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-104, Aligned region: 17..333
Protein Sequence: 356 a.a.     [Download]
>gi|66048181|ref|YP_238022.1| unnamed protein product [Pseudomonas syringae pv. syringae B728a]
MAPANRRSTPGLIDQARAEPHRFEFFQLVRLLRLHYSRNGRMDLETRPHEDPLRFRSQLSLNFPASEVSD
LQFEREGKLSAAGLPLSEVQVTFMGLVGPSGVLPRPYTELLIDRHIQYRDDAAHAFLDIFSHRMTTLFYE
AWQKYKFYIEYERNGTSNFDRYLLNLVGFGPEGLKQKFDKGESPLRRELFSYFSGMFAQKPRNALNLEVM
LSFYFSLPFKIQQFAGRWLKLDSSQCTQLGRKNAVLGQSAVAGNRVWDYQSCVRIEMGPLELADYQRFQP
GTEDYQKLVELVRFYIGAELDFQIAPELKREAVPVARLGRQGNVSLGWLGWLKRPGVDVEPSRCAVFHIP
FDGVSL
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|66043271|ref|NC_007005.1|:5875673-5876743 Pseudomonas syringae pv. syringae B728a chromosome, complete genome
ATGGCCCCCGCGAACAGGCGATCAACCCCTGGTCTGATCGACCAGGCAAGGGCTGAGCCGCACCGATTCG
AATTTTTCCAGTTGGTGCGTTTGCTTCGCCTGCACTACAGCAGGAACGGGCGTATGGACCTGGAAACCAG
GCCGCACGAAGACCCTCTGCGCTTTCGTTCGCAGCTGTCGCTGAACTTCCCGGCCAGTGAAGTCAGCGAC
CTGCAGTTCGAACGCGAAGGCAAGCTCTCGGCGGCAGGTTTGCCGCTGTCCGAAGTGCAGGTCACGTTCA
TGGGCCTGGTCGGTCCTTCGGGTGTGCTGCCGCGCCCGTACACCGAGCTATTGATCGACCGACATATTCA
GTATCGAGACGACGCTGCACATGCGTTTCTGGATATTTTTTCGCATCGCATGACCACGCTGTTTTACGAG
GCGTGGCAGAAGTACAAGTTTTACATCGAGTACGAGCGCAACGGCACTTCGAACTTCGACCGTTATTTGC
TCAACCTGGTGGGTTTCGGTCCAGAAGGCCTGAAGCAGAAGTTCGACAAGGGCGAGTCTCCCCTGCGCCG
CGAACTGTTCAGCTACTTCTCGGGGATGTTCGCGCAGAAGCCGCGCAACGCCCTGAACCTTGAGGTCATG
CTGAGTTTTTACTTCTCGCTGCCGTTCAAGATCCAGCAGTTCGCCGGACGCTGGCTGAAGCTCGACAGCA
GCCAGTGCACGCAGCTGGGCCGCAAGAACGCCGTGCTGGGGCAAAGCGCCGTGGCCGGCAATCGCGTCTG
GGATTACCAGTCGTGTGTACGTATCGAAATGGGTCCTCTGGAACTGGCCGACTACCAGCGCTTTCAGCCG
GGCACCGAGGATTACCAGAAGCTTGTTGAACTGGTGCGTTTTTACATCGGTGCCGAACTGGACTTCCAGA
TTGCGCCGGAGCTCAAGCGCGAAGCTGTACCCGTGGCCCGCCTGGGTCGCCAAGGCAATGTATCGCTGGG
CTGGCTTGGCTGGCTCAAACGCCCCGGTGTCGACGTGGAGCCTTCCCGTTGCGCCGTTTTCCATATTCCT
TTTGATGGGGTCTCCCTGTGA