SecReT6
Protein ID: 66048182
SecReT6 ID86
T6SS typei4b
Gene symbol-
Locus tagPsyr_4958
StrainPseudomonas syringae pv. syringae B728a
Repliconchromosome [GenBank: NC_007005] [Browse all T6SS(s) in this replicon]
Location [Strand]5876740..5879343 [+]
ProductATPase AAA
NoteTssH
UniProt IDQ4ZLI7
KEGG IDpsb:Psyr_4958
PDB IDNA
Domain hit(s) vs Pfam AAA [PF00004], Evalue: 2.30E-19, Aligned region: 38..66
AAA_2 [PF07724], Evalue: 9.80E-44, Aligned region: 225..242
AAA_2 [PF07724], Evalue: 9.80E-44, Aligned region: 598..765
AAA_2 [PF07724], Evalue: 9.80E-44, Aligned region: 819..839
AAA [PF00004], Evalue: 2.30E-19, Aligned region: 225..338
AAA [PF00004], Evalue: 2.30E-19, Aligned region: 604..724
AAA [PF00004], Evalue: 2.30E-19, Aligned region: 776..803
AAA_5 [PF07728], Evalue: 2.90E-14, Aligned region: 225..245
AAA_5 [PF07728], Evalue: 2.90E-14, Aligned region: 299..355
AAA_5 [PF07728], Evalue: 2.90E-14, Aligned region: 603..724
ClpB_D2-small [PF10431], Evalue: 1.60E-13, Aligned region: 775..845
AAA_16 [PF13191], Evalue: 5.90E-11, Aligned region: 202..256
AAA_16 [PF13191], Evalue: 5.90E-11, Aligned region: 270..303
AAA_16 [PF13191], Evalue: 5.90E-11, Aligned region: 464..464
AAA_16 [PF13191], Evalue: 5.90E-11, Aligned region: 598..646
AAA_16 [PF13191], Evalue: 5.90E-11, Aligned region: 668..692
AAA_16 [PF13191], Evalue: 5.90E-11, Aligned region: 788..810
AAA_22 [PF13401], Evalue: 9.80E-10, Aligned region: 224..311
AAA_22 [PF13401], Evalue: 9.80E-10, Aligned region: 342..397
AAA_22 [PF13401], Evalue: 9.80E-10, Aligned region: 601..646
Clp_N [PF02861], Evalue: 1.50E-08, Aligned region: 21..73
Clp_N [PF02861], Evalue: 1.50E-08, Aligned region: 103..127
Arch_ATPase [PF01637], Evalue: 2.20E-06, Aligned region: 204..239
Arch_ATPase [PF01637], Evalue: 2.20E-06, Aligned region: 278..382
Arch_ATPase [PF01637], Evalue: 2.20E-06, Aligned region: 602..647
Sigma54_activat [PF00158], Evalue: 5.30E-06, Aligned region: 221..240
Sigma54_activat [PF00158], Evalue: 5.30E-06, Aligned region: 603..721
AAA_19 [PF13245], Evalue: 8.20E-06, Aligned region: 225..246
AAA_19 [PF13245], Evalue: 8.20E-06, Aligned region: 601..625
AAA_14 [PF13173], Evalue: 1.20E-05, Aligned region: 225..357
AAA_14 [PF13173], Evalue: 1.20E-05, Aligned region: 354..391
AAA_14 [PF13173], Evalue: 1.20E-05, Aligned region: 602..684
IstB_IS21 [PF01695], Evalue: 2.10E-05, Aligned region: 219..249
IstB_IS21 [PF01695], Evalue: 2.10E-05, Aligned region: 603..624
AAA_17 [PF13207], Evalue: 6.20E-05, Aligned region: 225..293
AAA_17 [PF13207], Evalue: 6.20E-05, Aligned region: 604..641
AAA_25 [PF13481], Evalue: 0.00027, Aligned region: 225..249
AAA_25 [PF13481], Evalue: 0.00027, Aligned region: 350..385
AAA_25 [PF13481], Evalue: 0.00027, Aligned region: 601..624
NACHT [PF05729], Evalue: 0.00027, Aligned region: 225..252
NACHT [PF05729], Evalue: 0.00027, Aligned region: 603..628
AAA_29 [PF13555], Evalue: 0.00075, Aligned region: 218..241
AAA_29 [PF13555], Evalue: 0.00075, Aligned region: 601..628
Zeta_toxin [PF06414], Evalue: 0.00084, Aligned region: 220..243
Zeta_toxin [PF06414], Evalue: 0.00084, Aligned region: 597..643
AAA_18 [PF13238], Evalue: 0.0023, Aligned region: 225..245
AAA_18 [PF13238], Evalue: 0.0023, Aligned region: 605..628
AAA_30 [PF13604], Evalue: 0.0063, Aligned region: 212..287
AAA_30 [PF13604], Evalue: 0.0063, Aligned region: 602..634
Protein Sequence: 867 a.a.     [Download]
>gi|66048182|ref|YP_238023.1| unnamed protein product [Pseudomonas syringae pv. syringae B728a]
MNLKSLFAKLNETSRTATESAAALCLSENHYDVEVEHLLLQLLDNNDNDLPVILRHYDVVPDRLQAQLVT
ALGTFKKGNTRTPALSPHITRMIEQAWVLASIEFGQSQIRTGHLVQALLDDDALRRVVIGSAPELEKINA
DDLRLNMSALVEGSPETKLSKPLANADASTGATTKGNGKTPALDQYTVNLTQSARDGRIDPVLGREFEVR
QMVDILTRRRQNNPILTGEAGVGKTAVVEGLALRIVQGDVPSVLKGVAIHTLDLGLLQAGAGVKGEFENR
LKSVIEETKRSLHPIILFIDEAHTLIGSGGQAGQNDAANLLKPALARGELRTIAATTWAEYKKYFEKDAA
LARRFQVVKVEEPDEDKAIHMLRGLLAKMQEHHKVTVMDEALVQAVRLSNRYITGRQLPDKAVSVLDTAC
ARVALGQSAQPGALEDCKRHIDNLNAEITVLEQETAKGSDHARRLTALHEELQAEQETRESLEQQWKREL
ELVEKLGALSVPQSGEPDAGQIAAVRAELASVQGEQPLVHALVDGGTIGEVISGWTGIPLGKMLRDEIDT
VQSLPALLGERVLGQDHALEEIGKRIKISRARMEDPNKPIGVFLLLGPSGVGKTETALALADTLYGGERN
VITINMSEYQEAHTVSSLKGSPPGYVGYGEGGVLTEAVRRKPYSVVLLDEVEKAHPDVLELFFQVFDKGV
LDDGEGREINFRNTVIILTSNTGTDRIMQWCLNTEQKPTPDDIVEGLRDELNQVFKPAFLGRLTIVPYYP
VQDAILERIVGLKLERIRKRFERNHQAVLRYDEALIKAIASRCTEVDSGARNIDNILSKTLMPELAQRVL
ERMAQDKPIQSLTIDLGSDGDFAYTLT
 
Nucleotide Sequence: 2604 bp     [Download]
>gi|66043271|ref|NC_007005.1|:5876740-5879343 Pseudomonas syringae pv. syringae B728a chromosome, complete genome
GTGAACCTGAAGTCCCTGTTCGCCAAGCTGAACGAAACGAGCCGCACTGCCACTGAAAGCGCTGCTGCGC
TGTGCCTGTCGGAGAACCATTACGACGTTGAAGTCGAGCACTTGCTGCTGCAACTGCTCGATAACAACGA
CAACGATCTGCCAGTGATCCTGCGCCACTACGATGTGGTGCCTGATCGCCTGCAGGCACAGTTGGTCACT
GCGCTGGGGACGTTCAAGAAAGGCAACACGCGGACGCCTGCGCTCTCGCCGCACATCACGCGCATGATCG
AGCAGGCTTGGGTGCTGGCATCGATCGAGTTCGGTCAGTCACAGATCCGTACCGGCCATCTTGTGCAGGC
CTTGCTGGATGACGATGCACTGCGTCGCGTGGTCATCGGCTCGGCGCCGGAGCTGGAGAAGATCAACGCT
GACGACCTGCGCCTGAACATGAGCGCGCTGGTCGAGGGCAGCCCCGAGACCAAGCTGAGCAAGCCACTGG
CGAACGCCGACGCCAGCACGGGCGCCACCACCAAAGGTAACGGCAAGACGCCAGCCCTGGACCAGTACAC
CGTCAACCTGACCCAGAGCGCTCGCGATGGTCGCATTGACCCGGTGCTGGGACGCGAATTCGAAGTGCGG
CAGATGGTCGACATCCTGACCCGCCGCCGCCAGAACAACCCGATCCTGACCGGTGAAGCCGGCGTCGGTA
AAACAGCCGTGGTGGAAGGCCTGGCGCTGCGCATTGTGCAGGGCGACGTGCCGTCGGTGCTCAAGGGCGT
TGCCATTCACACGCTGGATCTGGGCCTGTTGCAGGCCGGTGCCGGGGTCAAGGGCGAGTTCGAAAACCGC
CTCAAGTCGGTCATCGAAGAAACCAAACGCAGCCTGCACCCGATCATTCTGTTTATCGATGAAGCCCACA
CGCTGATCGGTTCGGGCGGGCAAGCCGGGCAGAACGATGCCGCCAACCTGCTCAAGCCTGCCTTGGCACG
CGGTGAGCTGCGCACCATCGCCGCCACAACCTGGGCCGAGTACAAAAAGTATTTCGAGAAGGATGCCGCA
CTGGCTCGACGCTTCCAGGTGGTGAAAGTCGAAGAGCCTGACGAAGACAAGGCCATCCACATGCTTCGCG
GGTTGCTGGCGAAGATGCAGGAACACCACAAGGTCACGGTGATGGATGAAGCGCTGGTGCAGGCCGTGCG
CCTGTCCAACCGCTACATCACCGGCCGCCAGTTGCCGGACAAGGCAGTCAGCGTACTCGACACCGCTTGC
GCACGCGTTGCCCTGGGCCAGTCGGCACAGCCGGGAGCGCTGGAGGACTGCAAGCGTCACATCGACAACC
TGAACGCGGAAATCACCGTACTGGAGCAGGAAACCGCCAAGGGCAGCGACCACGCTCGGCGTCTGACGGC
CCTGCACGAAGAGCTGCAGGCCGAACAGGAGACCCGCGAGTCGCTGGAGCAACAGTGGAAGCGCGAGCTG
GAGCTGGTCGAGAAGCTTGGCGCACTCAGCGTTCCGCAAAGCGGCGAGCCTGATGCCGGGCAGATTGCCG
CCGTACGCGCCGAACTAGCCAGCGTGCAGGGCGAGCAACCGCTGGTCCACGCACTGGTCGATGGCGGCAC
GATTGGCGAAGTGATTTCCGGCTGGACCGGCATTCCGCTGGGCAAGATGCTGCGCGACGAAATCGACACC
GTGCAGAGCCTGCCCGCGCTGCTGGGCGAACGCGTACTGGGTCAGGACCATGCACTCGAAGAAATCGGCA
AGCGCATCAAGATTTCCCGTGCCCGCATGGAAGACCCGAACAAGCCGATCGGCGTGTTCCTGCTGCTGGG
CCCGAGCGGCGTCGGCAAGACCGAAACGGCACTGGCCCTGGCTGACACGCTGTATGGCGGCGAACGTAAC
GTCATCACCATCAACATGTCCGAATACCAGGAAGCCCACACCGTCTCCAGCCTGAAAGGCTCACCGCCTG
GCTACGTCGGTTACGGCGAAGGTGGCGTGCTCACCGAAGCCGTACGCCGCAAGCCTTATAGCGTGGTGCT
GCTCGACGAGGTGGAGAAAGCCCACCCGGATGTGCTCGAGCTGTTTTTCCAGGTCTTCGACAAAGGCGTG
CTGGACGATGGCGAAGGTCGCGAGATCAACTTCCGCAACACCGTGATCATCCTCACCTCCAACACCGGCA
CTGATCGCATCATGCAGTGGTGCCTGAACACAGAGCAGAAGCCGACCCCCGATGACATCGTGGAAGGCCT
GCGCGACGAGCTGAATCAGGTGTTCAAACCGGCCTTCCTGGGTCGCCTGACCATCGTGCCGTATTACCCG
GTACAGGACGCGATTCTGGAGCGCATCGTCGGCCTGAAGCTGGAGCGCATTCGCAAGCGTTTCGAGCGCA
ATCATCAGGCGGTGCTGCGTTACGACGAAGCACTGATAAAGGCTATCGCGTCGCGCTGCACGGAAGTCGA
CAGCGGCGCGCGCAATATCGACAACATCCTGTCCAAGACCCTCATGCCGGAGCTCGCTCAGCGGGTACTG
GAGCGGATGGCGCAGGACAAGCCGATTCAGAGCCTGACCATCGACCTGGGCAGCGATGGCGACTTCGCTT
ACACCCTGACCTGA