SecReT6
Protein ID: 66048183
SecReT6 ID86
T6SS typei4b
Gene symbol-
Locus tagPsyr_4959
StrainPseudomonas syringae pv. syringae B728a
Repliconchromosome [GenBank: NC_007005] [Browse all T6SS(s) in this replicon]
Location [Strand]5879369..5880124 [+]
Producthypothetical protein
NoteTssJ
UniProt IDQ4ZLI6
KEGG IDpsb:Psyr_4959
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.50E-32, Aligned region: 26..182
Protein Sequence: 251 a.a.     [Download]
>gi|66048183|ref|YP_238024.1| unnamed protein product [Pseudomonas syringae pv. syringae B728a]
MNKRLQGNCSSKPALARCLAVLAMMMALSACGVTDRVAKRMDDTWAGDMMFGDNEKVILTTDGGNQLNPD
EYGKPLSVVVRVYQLSSLERFESINADTLWEDPQKALGNTLVESRELILLPGMGQTDQWPLNPNASYVGI
AAFFRTDVDSRWKVAFDANTLRKDGIWFSSDGVRVLVDNNYILAVRGVDVLNKLKTEEQFNKSNSIPEQP
ASKSMTERAQDAAVQQVQDSAGSAAKKAADSQFNSLLEGAK
 
Nucleotide Sequence: 756 bp     [Download]
>gi|66043271|ref|NC_007005.1|:5879369-5880124 Pseudomonas syringae pv. syringae B728a chromosome, complete genome
ATGAATAAAAGACTTCAAGGCAATTGTTCCTCGAAGCCAGCCTTGGCAAGGTGCCTGGCTGTTCTGGCAA
TGATGATGGCTCTGTCCGCCTGCGGCGTGACAGACCGTGTCGCCAAGCGCATGGATGACACCTGGGCTGG
CGACATGATGTTCGGTGACAATGAAAAGGTCATCCTGACGACTGACGGCGGCAACCAGCTCAACCCCGAC
GAGTACGGCAAACCGCTCTCGGTGGTGGTGCGCGTTTATCAACTGTCCTCTCTGGAGCGCTTCGAGTCGA
TCAACGCCGACACTCTCTGGGAGGATCCGCAAAAGGCTCTGGGCAACACGCTGGTCGAGAGCCGGGAGCT
GATTCTGTTGCCTGGCATGGGCCAGACCGATCAGTGGCCGCTGAACCCGAATGCCTCGTATGTGGGCATC
GCGGCGTTCTTCCGCACCGACGTCGACAGCCGCTGGAAGGTCGCGTTCGACGCCAACACGCTGCGCAAGG
ACGGTATCTGGTTCTCGTCCGACGGCGTGCGTGTGCTGGTGGATAACAACTACATCCTCGCGGTGCGTGG
TGTGGACGTGCTGAACAAACTCAAGACTGAAGAGCAGTTCAACAAATCCAATTCGATTCCCGAACAACCC
GCCAGTAAAAGTATGACCGAGCGCGCGCAGGACGCAGCTGTCCAGCAGGTTCAGGACTCGGCCGGCAGTG
CTGCCAAAAAGGCAGCTGACTCACAATTCAATTCTCTGTTGGAAGGCGCCAAATGA