SecReT6
Protein ID: 66048184
SecReT6 ID86
T6SS typei4b
Gene symbol-
Locus tagPsyr_4960
StrainPseudomonas syringae pv. syringae B728a
Repliconchromosome [GenBank: NC_007005] [Browse all T6SS(s) in this replicon]
Location [Strand]5880121..5881464 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ4ZLI5
KEGG IDpsb:Psyr_4960
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 7.00E-133, Aligned region: 19..445
Protein Sequence: 447 a.a.     [Download]
>gi|66048184|ref|YP_238025.1| unnamed protein product [Pseudomonas syringae pv. syringae B728a]
MSKQSRVMWSEGMFLLPQHFQYQDEFHQHQLAESTLRSTPFHWGVQTLEVDVEALATGSLQLKRLKLVFP
DGSLYDAPQHDPLPAARDLKNLLKGGEIKVYAALKLPEPFGLNYVEDGQEQKSARRFRKQFDTLPDLNEG
DLENEITSLRLNVVMLVDGDSLDGYSYCPIARLARNSIGGFNLDAHFVHPTLHVGTHETLVGLGRRLISV
LQAKSKALSGRRRERADQIAEFGSSDVTLFWLLNTVNRAYPQLAHLLAHPRLHPERLYLFLAELAGGLLT
FSLDTQLTDIPDYDHQDPAASLVKLDELVRLLLENVIPNQCIVINLSQVRPSYWQGQLLDPRLTEADFYI
SVHADMPGSSLLELVPRAFKVGSPEDIEVVVNSAMPGVTLNHSTRLPNAIPVRLDNHYFSIEPHGRVYER
MMEAQAISFYAPSAFTNLKLELLAVLK
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|66043271|ref|NC_007005.1|:5880121-5881464 Pseudomonas syringae pv. syringae B728a chromosome, complete genome
ATGAGTAAACAAAGCCGCGTGATGTGGTCGGAAGGCATGTTCCTTTTGCCGCAACATTTCCAATATCAGG
ATGAGTTTCATCAACATCAGCTTGCTGAGTCGACGCTGCGCTCCACGCCCTTTCACTGGGGCGTGCAAAC
GCTGGAAGTCGACGTCGAGGCGCTGGCGACAGGCTCCCTGCAACTGAAGCGTCTGAAGCTGGTGTTCCCG
GACGGCAGCCTTTACGACGCGCCGCAGCACGACCCGCTGCCCGCCGCCCGCGACCTGAAAAACCTGCTCA
AAGGCGGAGAAATCAAGGTCTACGCGGCGCTCAAACTGCCTGAGCCCTTTGGCCTGAATTACGTTGAAGA
CGGCCAGGAACAGAAGAGCGCGCGACGTTTTCGCAAACAGTTCGACACCCTGCCGGACCTCAACGAAGGC
GATCTGGAAAACGAAATCACCAGCCTGCGCCTGAACGTGGTGATGCTGGTCGATGGCGACAGTCTGGATG
GCTACAGCTATTGCCCGATTGCCCGACTGGCACGCAACAGCATTGGCGGCTTCAACCTGGATGCGCATTT
TGTGCACCCGACGCTGCACGTGGGCACCCACGAGACGCTGGTCGGCCTCGGCAGACGTTTGATCAGCGTG
CTGCAAGCCAAGAGCAAGGCGCTTTCAGGCCGCCGCCGCGAGCGCGCTGACCAGATCGCCGAGTTCGGCT
CCAGCGACGTCACCTTGTTCTGGCTGCTGAATACCGTCAACCGCGCCTACCCGCAACTGGCTCACCTGCT
GGCGCATCCACGCCTGCACCCGGAGCGCCTGTATCTGTTTCTGGCGGAACTGGCGGGTGGTTTGCTGACC
TTCTCGCTGGACACCCAGCTCACCGACATCCCCGATTACGATCATCAGGACCCGGCGGCCTCGTTGGTCA
AGCTCGACGAACTGGTTCGTCTGCTGCTTGAAAACGTGATTCCGAACCAGTGCATCGTCATCAACCTGAG
TCAGGTCCGGCCTTCGTACTGGCAGGGCCAGTTGCTGGACCCGCGTCTTACCGAAGCCGACTTTTACATC
TCGGTGCATGCCGACATGCCCGGCTCCAGCCTGCTGGAACTGGTGCCGCGCGCCTTCAAGGTCGGTTCGC
CGGAAGACATCGAAGTGGTGGTCAACAGCGCCATGCCGGGCGTCACGCTGAACCACTCGACGCGCCTGCC
AAACGCCATTCCGGTGCGCCTGGACAACCATTACTTCTCCATCGAGCCGCATGGCCGCGTGTACGAACGC
ATGATGGAAGCCCAGGCCATTTCCTTCTACGCGCCCAGCGCGTTTACCAATCTCAAGCTCGAACTGTTGG
CGGTGCTTAAATGA