SecReT6
Protein ID: 66048185
SecReT6 ID86
T6SS typei4b
Gene symbol-
Locus tagPsyr_4961
StrainPseudomonas syringae pv. syringae B728a
Repliconchromosome [GenBank: NC_007005] [Browse all T6SS(s) in this replicon]
Location [Strand]5881461..5882174 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ4ZLI4
KEGG IDpsb:Psyr_4961
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.00E-54, Aligned region: 18..220
Protein Sequence: 237 a.a.     [Download]
>gi|66048185|ref|YP_238026.1| unnamed protein product [Pseudomonas syringae pv. syringae B728a]
MTEAVMQGAATAATEKPTLKDLVRDFITMALIVRRGRQAISVTAFESSVDTFFANLERQARSANYSVEQV
KDAQYALCAFLDESVLRSGDNDMRRHFEMEPLQFRYFGVHLAGEGFFEKIELLRADVKKNLDVLEVYHLC
LALGFEGKFGLGQKDQLRYLANTLGQDIARYRKTPKALSPDWALPDQVSQMLRHEVPVWLYLVLIALVCL
GVYLTLDWLLGKDVAALAEQISQLFNA
 
Nucleotide Sequence: 714 bp     [Download]
>gi|66043271|ref|NC_007005.1|:5881461-5882174 Pseudomonas syringae pv. syringae B728a chromosome, complete genome
ATGACTGAAGCCGTGATGCAAGGTGCCGCTACGGCCGCAACCGAAAAACCTACGCTCAAAGACCTGGTGC
GTGACTTCATCACCATGGCGCTGATTGTCCGTCGCGGCCGTCAGGCGATCTCGGTCACCGCCTTCGAATC
CAGCGTCGATACTTTTTTCGCCAACCTGGAGCGTCAGGCGCGCAGCGCCAACTACAGCGTCGAACAGGTC
AAGGACGCCCAATACGCACTGTGCGCATTCCTCGATGAGAGCGTGCTGCGTTCGGGCGACAACGACATGC
GTCGCCACTTCGAAATGGAGCCGTTGCAGTTCCGTTATTTCGGGGTTCACCTGGCGGGCGAAGGCTTCTT
CGAGAAAATCGAACTGCTGCGCGCCGACGTGAAAAAGAACCTGGATGTGCTCGAGGTGTATCACCTGTGC
CTGGCCCTGGGTTTCGAAGGCAAATTCGGGCTGGGTCAGAAGGACCAGTTGCGCTACCTGGCCAACACGC
TGGGCCAGGACATCGCACGCTACCGCAAGACGCCAAAGGCGCTGTCGCCTGACTGGGCATTGCCTGACCA
GGTGTCGCAAATGCTGCGCCATGAAGTTCCGGTATGGCTTTACCTGGTGCTCATCGCCCTCGTATGCCTG
GGTGTCTATCTGACGCTTGACTGGTTGCTGGGCAAAGACGTGGCCGCGTTGGCCGAACAAATCAGCCAAC
TGTTCAATGCTTGA