SecReT6
Protein ID: 66048190
SecReT6 ID86
T6SS typei4b
Gene symbol-
Locus tagPsyr_4966
StrainPseudomonas syringae pv. syringae B728a
Repliconchromosome [GenBank: NC_007005] [Browse all T6SS(s) in this replicon]
Location [Strand]5890348..5891442 [+]
ProductImpA-like protein
NoteTssA
UniProt IDQ4ZLH9
KEGG IDpsb:Psyr_4966
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.80E-19, Aligned region: 58..118
Protein Sequence: 364 a.a.     [Download]
>gi|66048190|ref|YP_238031.1| unnamed protein product [Pseudomonas syringae pv. syringae B728a]
MSEFLNDLSLADLTAPINGGSGEDLSFSTLFDQVKEARRADPDYLTQGDWQTDLKSSDWEQTITLAAQGL
AEQSKDLMLVAWLSEALAHKYHFVGITFGLTVAERILQNFWDDLYPSLEDGVEERAARLAWLKTTLTEVV
GGLPITQGQNFGLLRYDESRHVENLALQNPKAMQSAVEEGKINAEIFQRSVVLTDSDHLRLKASEIAASL
YACQQLQATADTLFGRDAPSLVTLSDILQRAGQLTEKLLKDRGIELSPAPAAAQAAPETVVDQPAGAVMT
QASQDSASAPLRTTPTTRDEAFTMLAGIAQFFKNTEPQSPVPYLIERAIKWGNMPLEGWLNDVIKDSNVV
DSIRDVLGTKEPKQ
 
Nucleotide Sequence: 1095 bp     [Download]
>gi|66043271|ref|NC_007005.1|:5890348-5891442 Pseudomonas syringae pv. syringae B728a chromosome, complete genome
ATGTCTGAATTTCTCAACGACCTTTCGCTTGCCGATCTGACGGCACCCATCAACGGGGGAAGTGGCGAGG
ACCTGAGCTTTTCCACCCTGTTCGATCAGGTCAAGGAAGCTCGTCGAGCAGACCCCGACTACCTCACCCA
AGGTGACTGGCAAACCGATCTCAAGTCCTCGGACTGGGAACAGACCATCACCTTGGCCGCACAGGGCCTT
GCCGAACAAAGCAAGGACCTGATGCTCGTCGCCTGGCTCAGCGAAGCCCTGGCGCACAAATACCACTTTG
TCGGCATCACCTTCGGCCTGACCGTGGCCGAGCGGATCCTGCAAAACTTCTGGGACGATCTGTACCCATC
TCTGGAAGATGGCGTAGAAGAACGTGCCGCCCGCCTGGCCTGGCTGAAAACCACGCTGACCGAAGTCGTC
GGCGGGCTGCCGATCACGCAGGGGCAGAATTTTGGCCTGTTGCGCTACGACGAGTCGCGCCACGTTGAAA
ACCTCGCGCTGCAAAACCCCAAGGCCATGCAGTCCGCTGTTGAAGAAGGCAAGATCAACGCCGAAATCTT
CCAGCGCTCGGTGGTCCTGACCGACTCGGATCATCTGCGCCTCAAGGCCAGCGAAATCGCCGCCAGCCTG
TACGCCTGCCAGCAGCTCCAGGCCACTGCCGACACACTGTTCGGCCGCGACGCGCCGAGCCTTGTCACCC
TCAGCGACATACTGCAACGCGCCGGGCAACTGACCGAAAAGCTGCTCAAGGACCGAGGTATCGAACTGAG
CCCCGCCCCCGCCGCCGCTCAGGCCGCACCCGAAACCGTCGTCGACCAACCCGCAGGTGCCGTAATGACC
CAGGCCAGCCAGGACAGCGCGTCCGCACCACTGCGCACCACCCCGACCACACGCGACGAAGCCTTCACCA
TGCTCGCCGGCATCGCACAGTTCTTCAAAAACACCGAGCCGCAAAGCCCCGTCCCGTACCTCATCGAGCG
CGCCATCAAGTGGGGCAACATGCCGCTGGAAGGCTGGCTGAACGACGTCATCAAGGACAGCAACGTCGTG
GACAGCATTCGCGATGTGCTGGGTACGAAAGAGCCTAAGCAGTAA