SecReT6
Protein ID: 66048198
SecReT6 ID86
T6SS typei4b
Gene symbol-
Locus tagPsyr_4974
StrainPseudomonas syringae pv. syringae B728a
Repliconchromosome [GenBank: NC_007005] [Browse all T6SS(s) in this replicon]
Location [Strand]5898317..5901193 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ4ZLH1
KEGG IDpsb:Psyr_4974
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.30E-71, Aligned region: 42..349
DUF2345 [PF10106], Evalue: 6.60E-57, Aligned region: 673..824
T6SS_Vgr [PF13296], Evalue: 6.60E-41, Aligned region: 306..322
T6SS_Vgr [PF13296], Evalue: 6.60E-41, Aligned region: 512..620
T6SS_Vgr [PF13296], Evalue: 6.60E-41, Aligned region: 705..719
Phage_base_V [PF04717], Evalue: 1.90E-19, Aligned region: 410..500
Sarcoglycan_1 [PF04790], Evalue: 0.004, Aligned region: 710..804
Fil_haemagg_2 [PF13332], Evalue: 0.0078, Aligned region: 637..721
Fil_haemagg_2 [PF13332], Evalue: 0.0078, Aligned region: 797..814
Protein Sequence: 958 a.a.     [Download]
>gi|66048198|ref|YP_238039.1| unnamed protein product [Pseudomonas syringae pv. syringae B728a]
MNSILDAAMNAFSGPLSQAGRLLELNTPQGQELFALRAHAVERLSHVARYTVDVINQTTDFDPEKLIGQA
VQLSIRLDDGSLSPRHGWVESVRYLGSDGGLEDWQLVFAPWFSLLEYRIDCRIWQEMSLPDILAQVFQHY
SQARANYRFDLQRDYPLLSYVTQFNETDANFVQRWCEQEGLFWYVEHKVDSHCIVFTDNIDSLPTLNPAS
LRFHTQQAADLKDSITQWSPGARLLNGLVQWRSSEYRSHAQPQITHSMALPAASAPPDLERYQYRGQYAW
QNLGRGEWLARVQIEQDESAARRIQGQGGARQMQPGHGFELTQHPLYELKPLQDRQFLIVAVEFFVQSNL
PIGKTRSSPPGSLKTQLDALQTQASLPAGDEGFYLNRFETQRLDIPYRSAFTHQKPAHPGPQTAVVVTPG
GHEVFTDNLNRVCVRFHWDRLVKDGELGSCWLRMMQSSSGQDWGSVNVPRAGEEVVVTFLDNDIDRPLIM
GQVYGGHKPAWHSSGLMSGYKSQEIQGSGYNQWVMDDSTGQVRTQIHSSHGHSQLNLGYLIDQQGNSRGA
LRGAGFELRTDAYGALRAQQGLYLSTWPRNKAQGGQIDTQEAQQHLSNAQARVKALSEIAEQHNALPMPG
GIESLDQLNADTQANYGSGGESPVSSSPQQRNGGDTKAAIMSGGRGQTSGYKKPLLVASSPADIATVTPQ
NTHIHSGKQLTLSTGEDTNLASGKSLLVSVAQSISLFAQAAGAKLFAAKGKVEIQAQNDSIELTAKESVR
ITSTARTIEIAAQEEILLTSGAAYIRIKGGNIEIHAPGTIDVKGVKKTFDGPAQLNRDNPAWPTDSIKQK
LTAYAGLSSAAGYQAWAGQPYTIFADGAEVKKGVMDASGQIAIDHHATTSQYRIDLSNGVSYDLPVAADY
KGDPKNAELANRGLHRHESASHPDVKPSDNRSLFRNRYDQLSNPESEA
 
Nucleotide Sequence: 2877 bp     [Download]
>gi|66043271|ref|NC_007005.1|:5898317-5901193 Pseudomonas syringae pv. syringae B728a chromosome, complete genome
ATGAATTCGATACTCGACGCTGCCATGAACGCCTTCAGCGGACCGCTCAGTCAGGCCGGTCGCCTGCTGG
AATTGAACACGCCGCAAGGTCAGGAGCTGTTTGCTCTGCGCGCGCATGCCGTGGAACGTCTGAGCCACGT
GGCGCGCTACACGGTCGACGTGATCAATCAGACCACCGACTTCGACCCGGAGAAGCTGATTGGTCAGGCA
GTGCAACTGAGCATTCGCCTCGACGACGGCAGCCTGAGCCCTCGGCATGGCTGGGTCGAGAGTGTGCGTT
ATCTCGGCAGCGATGGCGGGCTCGAGGATTGGCAGCTGGTCTTTGCGCCGTGGTTCAGCCTGCTGGAATA
CCGTATTGATTGCCGAATCTGGCAAGAAATGAGCTTGCCGGACATCCTTGCTCAGGTGTTTCAGCACTAC
AGCCAGGCCCGCGCCAACTACCGCTTCGACCTGCAACGCGACTACCCGCTGCTGTCATACGTGACGCAGT
TCAACGAGACCGACGCCAACTTCGTGCAGCGCTGGTGCGAGCAGGAAGGCCTTTTCTGGTACGTGGAGCA
CAAGGTCGACAGTCATTGCATCGTGTTTACCGACAACATTGACTCTCTGCCCACACTGAACCCCGCAAGC
CTGCGTTTCCATACCCAGCAGGCCGCCGACCTGAAAGACAGCATCACCCAATGGAGCCCCGGCGCCCGCC
TGCTCAATGGCCTGGTGCAGTGGCGCAGCAGCGAATACCGCAGCCATGCGCAGCCACAGATCACTCACTC
CATGGCACTGCCTGCCGCATCCGCGCCTCCTGACCTCGAGCGTTACCAATACCGTGGCCAGTATGCATGG
CAGAACCTCGGCCGCGGCGAATGGCTCGCGCGCGTGCAGATCGAACAGGATGAGTCGGCGGCCCGTCGCA
TTCAGGGTCAGGGCGGGGCTCGTCAGATGCAGCCCGGTCATGGCTTTGAGCTGACCCAACATCCGCTTTA
CGAGCTCAAGCCGCTCCAGGACCGTCAGTTCCTGATCGTCGCCGTGGAGTTCTTTGTGCAGAGCAACCTG
CCAATCGGCAAGACGCGATCAAGCCCACCCGGGAGCCTGAAAACACAGTTGGATGCACTGCAGACGCAAG
CTTCGCTACCGGCGGGCGATGAAGGCTTCTACCTGAATCGCTTTGAAACACAGCGTCTGGATATTCCCTA
TCGCAGCGCGTTTACCCATCAAAAACCGGCGCACCCCGGCCCGCAGACAGCAGTCGTCGTGACACCCGGC
GGGCATGAGGTTTTCACCGATAACCTGAACCGGGTTTGCGTTCGCTTTCACTGGGATCGTCTGGTGAAGG
ATGGAGAGCTTGGTTCGTGCTGGCTGCGCATGATGCAGTCGAGCAGCGGTCAGGACTGGGGCAGCGTCAA
TGTGCCGCGCGCTGGCGAAGAGGTAGTCGTCACCTTTCTTGATAACGATATCGACCGTCCGCTGATCATG
GGACAGGTCTACGGCGGACATAAGCCTGCGTGGCATTCCAGCGGCCTGATGAGTGGCTATAAAAGTCAGG
AGATTCAGGGGAGCGGCTATAACCAGTGGGTGATGGACGATTCCACCGGCCAGGTCAGAACCCAGATCCA
CAGTAGCCATGGGCATAGTCAGCTGAACCTCGGTTACCTGATCGACCAACAGGGCAATTCACGAGGCGCA
CTGCGCGGTGCCGGTTTCGAGCTGCGGACTGACGCCTACGGTGCCTTGCGTGCTCAGCAAGGTCTGTACT
TGAGCACTTGGCCGCGCAACAAGGCGCAGGGCGGGCAGATTGATACCCAGGAAGCTCAACAGCATCTGAG
CAACGCTCAGGCACGAGTGAAGGCATTGTCGGAAATTGCCGAGCAGCACAATGCGCTGCCCATGCCGGGC
GGTATTGAAAGTCTCGACCAGCTCAACGCCGATACCCAGGCCAATTACGGCAGCGGCGGCGAAAGCCCGG
TCAGCAGCAGTCCGCAGCAACGTAACGGCGGTGATACCAAGGCGGCGATCATGAGCGGCGGTCGTGGGCA
GACGTCAGGCTATAAAAAGCCCTTGCTGGTCGCATCCTCGCCCGCCGACATCGCGACCGTCACCCCGCAA
AATACTCACATCCACAGCGGTAAACAGTTAACGCTTTCAACCGGTGAAGACACCAATCTGGCCAGCGGCA
AGTCACTATTGGTGAGTGTCGCGCAAAGCATCAGTCTGTTCGCCCAGGCGGCAGGCGCCAAACTGTTTGC
AGCAAAGGGCAAAGTTGAAATACAGGCGCAAAACGACAGCATTGAACTGACCGCGAAGGAAAGCGTGCGC
ATCACCTCTACGGCTCGCACTATCGAGATCGCAGCGCAGGAAGAAATCCTGCTGACCAGCGGCGCAGCGT
ACATCCGCATCAAGGGTGGCAATATCGAGATTCATGCTCCCGGAACCATCGACGTAAAAGGCGTGAAAAA
GACTTTCGACGGCCCTGCGCAGCTCAATCGGGATAATCCGGCGTGGCCGACCGACTCGATCAAACAAAAG
CTTACAGCCTACGCCGGGCTTAGCAGTGCGGCGGGCTATCAGGCATGGGCAGGTCAGCCGTATACCATCT
TTGCAGACGGGGCCGAGGTCAAAAAAGGAGTGATGGACGCCAGCGGACAGATCGCCATCGACCATCACGC
TACAACCAGCCAGTACCGTATTGATCTGAGTAACGGCGTCAGCTACGACCTGCCAGTAGCGGCCGATTAC
AAAGGTGATCCCAAAAATGCGGAACTGGCCAACCGCGGGCTTCACCGCCACGAAAGCGCTTCGCACCCAG
ACGTCAAACCGAGCGACAATCGCAGTCTGTTCCGTAACAGGTATGACCAGTTGAGCAATCCAGAGTCGGA
GGCGTGA