SecReT6
Protein ID: 66048207
SecReT6 ID86
T6SS typei4b
Gene symbol-
Locus tagPsyr_4983
StrainPseudomonas syringae pv. syringae B728a
Repliconchromosome [GenBank: NC_007005] [Browse all T6SS(s) in this replicon]
Location [Strand]5908301..5910145 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ4ZLG2
KEGG IDpsb:Psyr_4983
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.90E-77, Aligned region: 35..344
Phage_base_V [PF04717], Evalue: 6.30E-26, Aligned region: 378..471
Gp5_C [PF06715], Evalue: 0.0018, Aligned region: 185..195
Gp5_C [PF06715], Evalue: 0.0018, Aligned region: 522..543
Protein Sequence: 614 a.a.     [Download]
>gi|66048207|ref|YP_238048.1| unnamed protein product [Pseudomonas syringae pv. syringae B728a]
MDLSSLFTAQNRRLFKLTMALKGGQELLLDSFAGSEGLSADFGFQLDLISDDASVKLKSAIGQSATIEIE
LATGGSRYINGHVLSFGNNGSDGGMSRYSAYIGSWLSLIAQRYDSQIYQDQTVEQVIRKVLGRYDGLAKY
EFRVNRTLKPYSYITQYRESDSHFVMRLLEQEGLFFYFEHTADSHTLIIMDDSTVLTPLPEQPQVRFHTA
SVTETSDSITHWSSAREFQAGKISVQTFDYRQPGNRIPVTMNSLNQQGDVPSYEIFDYMGQYTHGTPEDG
ELLVRNRIEALELKGKTFVGSSNCRAMRPGYTFELTQHYEHDTGSPDDRQFLLMNIEHRGSNNYTSGSQA
GYANKIYCVRKKIKFRPQMDLLKPGISGPQTAIVVGPPGEEIYTDEMGRVKVQFHWDRYGKFDDKSSCWV
RVAQSGASGGFGSMQIPRVGDEVVVVFLDGNPDRPLVMGSLYNSQNTPPWSLPANKTQSGFLTRSAKGDG
GTANFFRFEDKAGAEQVIMHAERNMDTEIELDEKHEVGNNRKVTVGGTNTEIIQKDTVTNVQQGSFTLKV
DNQFIQVDAKQYILLKVGDSSISITPEGIQIKGKVINVLGESTFVKGDRVDINK
 
Nucleotide Sequence: 1845 bp     [Download]
>gi|66043271|ref|NC_007005.1|:5908301-5910145 Pseudomonas syringae pv. syringae B728a chromosome, complete genome
ATGGATCTATCCTCACTGTTTACGGCGCAGAACAGACGACTGTTCAAGCTGACGATGGCCCTCAAGGGTG
GCCAGGAGCTGTTGCTTGATTCCTTTGCCGGTAGTGAAGGTTTATCGGCTGATTTCGGGTTTCAACTCGA
TCTGATTTCTGATGATGCGAGCGTAAAGCTTAAGTCCGCTATAGGGCAGTCCGCGACCATCGAAATCGAA
CTCGCCACCGGAGGCAGCCGTTACATTAACGGTCATGTATTGAGCTTCGGTAACAATGGCAGCGACGGTG
GCATGTCGCGCTATTCAGCCTACATAGGCTCGTGGTTGAGCCTGATTGCGCAGAGGTACGATTCTCAGAT
CTATCAGGATCAGACAGTGGAGCAGGTGATCCGGAAGGTATTGGGTCGCTACGATGGGCTTGCGAAGTAC
GAGTTCCGTGTCAATCGCACGCTCAAGCCATACAGCTACATCACCCAATACCGCGAAAGCGATAGTCACT
TCGTCATGCGCCTGCTGGAGCAGGAGGGTTTGTTCTTCTACTTTGAGCATACGGCGGACAGCCATACGCT
GATCATCATGGACGACTCGACTGTACTCACACCGCTTCCAGAGCAGCCCCAGGTTCGCTTCCATACAGCT
TCTGTAACCGAAACCTCTGACTCCATCACCCACTGGAGTTCAGCCCGGGAATTCCAGGCTGGCAAGATTT
CGGTACAAACCTTCGATTACAGGCAGCCAGGAAATCGTATTCCCGTCACGATGAACAGCCTTAATCAGCA
AGGCGATGTTCCATCGTATGAAATCTTTGATTACATGGGGCAGTACACGCACGGCACGCCCGAAGATGGT
GAGCTCCTCGTGCGTAATCGTATCGAGGCACTGGAGCTAAAAGGTAAGACATTCGTAGGGTCGAGTAACT
GTCGGGCGATGCGTCCAGGTTACACATTTGAACTGACGCAACATTACGAGCATGACACGGGCTCTCCCGA
TGATCGGCAGTTCCTGTTAATGAATATCGAGCATCGCGGCAGCAATAATTACACCTCGGGCAGTCAGGCG
GGTTACGCCAATAAAATTTATTGCGTACGCAAAAAAATCAAGTTCCGGCCTCAGATGGATTTGCTCAAGC
CAGGCATCTCCGGCCCCCAAACCGCCATCGTCGTCGGCCCGCCCGGCGAAGAAATCTACACCGACGAAAT
GGGCCGGGTAAAAGTGCAGTTCCACTGGGACCGCTACGGCAAGTTTGACGACAAAAGCTCCTGCTGGGTC
CGCGTCGCTCAATCCGGCGCAAGTGGCGGTTTTGGTAGCATGCAGATCCCGCGCGTCGGTGACGAGGTGG
TGGTCGTTTTCCTGGATGGCAACCCTGACCGTCCACTCGTCATGGGCAGTTTGTATAACAGCCAGAACAC
GCCGCCGTGGTCGCTGCCTGCCAACAAGACCCAGAGTGGTTTCCTGACGCGTTCGGCCAAGGGGGATGGC
GGTACGGCCAACTTCTTCCGCTTTGAAGATAAGGCCGGTGCCGAACAGGTGATCATGCATGCCGAGCGCA
ACATGGACACAGAGATCGAGCTGGATGAAAAGCACGAGGTGGGCAATAACCGCAAGGTGACGGTCGGCGG
CACGAATACGGAAATCATCCAGAAAGATACTGTGACGAACGTGCAGCAGGGGTCGTTTACGCTAAAGGTC
GACAACCAATTCATTCAGGTGGATGCCAAGCAGTACATCCTTCTCAAAGTGGGCGACAGCAGCATCTCGA
TCACTCCGGAAGGCATTCAGATAAAAGGCAAAGTGATCAATGTTCTTGGCGAGAGCACCTTCGTCAAAGG
TGACCGAGTCGACATCAACAAGTGA