SecReT6
Protein ID: 700289655
SecReT6 ID937
T6SS typei1
Gene symbolevfB
Locus tagevfB
StrainEscherichia coli DE719
RepliconT6SS [GenBank: KM251715] [Browse all T6SS(s) in this replicon]
Location [Strand]998..2356 [-]
ProductEvfB
NoteTssA
UniProt IDA0A097QQQ9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.30E-45, Aligned region: 91..156
DUF3702 [PF12486], Evalue: 2.30E-45, Aligned region: 258..271
DUF3702 [PF12486], Evalue: 2.30E-45, Aligned region: 288..434
ImpA-rel_N [PF06812], Evalue: 1.30E-20, Aligned region: 41..101
ImpA-rel_N [PF06812], Evalue: 1.30E-20, Aligned region: 254..261
Protein Sequence: 452 a.a.     [Download]
>gi|700289655|ref|AIU68800.1| EvfB [Escherichia coli]
MSNYALTQTIVTGSDPRALPEFSAIREEINKANHPSQPELNWKLVESLALSIFKANGVDLHTATYYTLAR
TRNQGLAGFCEGAELLAAMIIHEWDKFWPQSGPARTEMLDWFNTRTGNILRQQVSFSENDLSLLYRTERA
LQLICDKLQQVELKRQPRVENLLYFVQNTRKRFEPQPRNRTDTAAQTMVRTLVYAPEGTASATAETMPPL
PDLPEMRVGVRGVADNADKAKQGDTVKGFVAGAACTAVIASALWWWQAYPMQQQLTQVRDTTQGAATVWL
ASPVLKEYEQYLQQLLNAPPLQPLETGMQMMRTADTLWPESLQQQEASRMWSNTLRNRAQASPQMKGWQQ
ARQNLRDFADLMMKKETEKQGFTLSYIKTVTWQAERLLNQETPLEYLLTQYQETRTQKQDTQALEKEINE
RLDGLLSRWLLLKNTGQDMATDNRTEPVHPTH
 
Nucleotide Sequence: 1359 bp     [Download]
>gi|700289653|gb|KM251715|evfB|:998-2356
ATGAGCAATTACGCACTGACACAAACTATCGTTACCGGCAGCGATCCGCGCGCCCTGCCGGAGTTCAGCG
CCATCCGCGAAGAAATTAACAAAGCTAACCACCCGTCACAGCCGGAGCTGAACTGGAAACTGGTGGAATC
GCTGGCGCTGTCGATTTTTAAGGCCAACGGGGTGGATTTGCATACCGCCACCTACTATACGCTGGCACGT
ACACGTAATCAGGGACTGGCAGGGTTCTGTGAAGGCGCGGAACTGCTGGCTGCGATGATCATCCACGAAT
GGGATAAATTCTGGCCGCAGAGTGGTCCGGCGCGGACTGAGATGCTGGACTGGTTCAACACCCGCACCGG
GAATATCCTGCGCCAGCAGGTTTCCTTTTCCGAAAATGATCTTTCGTTGCTCTACCGCACGGAACGGGCT
TTGCAGCTTATCTGCGACAAACTCCAGCAAGTGGAACTGAAGCGCCAGCCGCGCGTGGAAAATCTGCTTT
ATTTTGTGCAGAACACACGCAAGCGGTTTGAGCCGCAGCCCAGAAACCGTACTGATACGGCGGCACAGAC
CATGGTCAGAACGCTGGTCTATGCGCCTGAAGGCACGGCTTCCGCCACAGCGGAAACCATGCCCCCCCTA
CCCGACCTGCCGGAAATGCGGGTGGGGGTGCGCGGTGTGGCAGATAACGCCGACAAAGCAAAACAGGGCG
ACACGGTAAAAGGTTTTGTTGCCGGTGCCGCCTGTACTGCCGTTATCGCATCTGCACTCTGGTGGTGGCA
GGCGTATCCGATGCAGCAGCAGCTTACACAGGTCAGGGATACCACACAGGGAGCCGCCACCGTCTGGTTG
GCATCCCCGGTACTGAAAGAATATGAACAGTACCTGCAACAGCTTCTGAATGCCCCGCCACTACAGCCGC
TGGAAACCGGAATGCAGATGATGCGCACCGCAGACACCCTCTGGCCGGAAAGCCTGCAACAGCAGGAAGC
CAGCAGGATGTGGAGCAACACGCTGAGAAACCGGGCGCAAGCCAGTCCGCAGATGAAGGGCTGGCAACAA
GCGCGGCAGAATTTGCGGGATTTTGCAGATTTGATGATGAAGAAGGAGACGGAGAAACAGGGTTTCACCC
TATCGTATATCAAAACGGTGACCTGGCAGGCCGAACGGTTACTGAATCAAGAAACACCACTGGAGTACCT
GCTGACGCAGTACCAGGAGACCCGTACACAGAAGCAGGACACACAGGCGTTGGAAAAAGAGATCAACGAA
CGGCTGGACGGGCTGTTAAGCCGCTGGCTGCTGCTGAAAAATACCGGACAGGATATGGCAACGGATAACA
GAACCGAACCTGTCCATCCAACTCATTGA

Protein ID: 700289659
SecReT6 ID937
T6SS typei1
Gene symbolevfF
Locus tagevfF
StrainEscherichia coli DE719
RepliconT6SS [GenBank: KM251715] [Browse all T6SS(s) in this replicon]
Location [Strand]5915..7357 [-]
ProductEvfF
NoteTssA
UniProt IDQ6TKT9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.00E-06, Aligned region: 54..111
ImpA-rel_N [PF06812], Evalue: 1.00E-06, Aligned region: 406..417
Protein Sequence: 480 a.a.     [Download]
>gi|700289659|ref|AIU68804.1| EvfF [Escherichia coli]
MAMDLRNPDVWLAHLLENLPEDKLSAALDDGNADWEFVDSEIVKLGSLAHSQLDIPELQRRGLMLLASET
KDFRLLAHLLRTLQHAGDILLASRMLAQYTEHYWTCAAPQNMAHKKRFAAQVIKRFESAVQDFAGNAATI
QRDALLGELAKLAQCWQAHNASELAKATDDLFSLFQRAFRDVAPEMTSSARSAAIAPQATTGYVPDMSPH
TVAAQPPVAATPIPQVTVENHDDKAWRDTLLKVAAILCERQPESPQGYRLRRHALWQTITSTPQAESDGR
TPLAAFPVDMMDDYLARLNNADMALWQQVEKSLLLAPYWLDGHYLSAQTALRLGYKQVADAIRDEVTDFL
ARLPALINLLFNDRTPFVSEQTKQWLASSGSVNQTVPVVQTDEELQAAKACFDENGLEAALRYLENLPEG
DPRHQFHRQFFGAQLLEEAGMVQLAQQQYRMLFRTGLHMMLSEWEPSLLKALEQKLTAEQ
 
Nucleotide Sequence: 1443 bp     [Download]
>gi|700289653|gb|KM251715|evfF|:5915-7357
ATGGCAATGGACTTACGTAATCCCGATGTATGGCTTGCACACCTGCTGGAAAACCTGCCAGAAGATAAGC
TGTCCGCCGCGCTTGATGATGGCAATGCAGACTGGGAGTTTGTCGACAGCGAAATCGTCAAGCTCGGTTC
ACTGGCGCACAGCCAGCTTGATATCCCGGAACTTCAGCGCCGGGGCCTGATGCTTCTGGCCTCAGAAACC
AAAGATTTTCGCCTGCTGGCCCACTTGCTGCGTACCCTGCAACATGCCGGTGATATTCTGCTGGCCTCCA
GGATGCTGGCACAATATACAGAGCACTACTGGACATGCGCCGCACCGCAGAACATGGCCCACAAAAAACG
CTTTGCCGCCCAGGTGATAAAACGCTTTGAGTCTGCCGTTCAGGACTTTGCCGGGAATGCTGCGACAATA
CAGCGCGATGCTTTGCTGGGAGAGCTGGCAAAACTGGCACAGTGCTGGCAGGCGCACAACGCGTCTGAGC
TGGCAAAGGCGACAGACGATTTATTTTCCCTGTTTCAGCGCGCGTTTCGTGATGTAGCGCCTGAAATGAC
ATCATCTGCACGAAGCGCCGCCATTGCGCCGCAGGCCACGACCGGATATGTACCGGATATGTCACCGCAC
ACGGTTGCCGCTCAGCCTCCTGTTGCAGCCACTCCAATCCCGCAGGTCACCGTTGAAAACCACGACGATA
AAGCATGGCGCGACACCCTGCTAAAGGTGGCCGCCATTCTCTGTGAGCGCCAGCCGGAGTCACCGCAGGG
TTACCGACTGCGCCGCCATGCGCTGTGGCAAACCATCACCAGTACCCCGCAGGCAGAAAGCGATGGCCGG
ACCCCACTGGCAGCCTTCCCTGTCGATATGATGGATGATTACCTGGCGCGGCTGAACAATGCCGACATGG
CGCTGTGGCAGCAGGTGGAAAAAAGCCTGCTGCTGGCCCCGTACTGGCTGGACGGTCATTACCTCTCAGC
ACAGACCGCGCTGCGCCTCGGTTATAAACAGGTGGCGGATGCTATCCGTGATGAAGTTACCGATTTTCTG
GCCCGCCTGCCCGCACTGATCAACCTGTTGTTTAACGACCGCACTCCGTTTGTGTCCGAACAGACGAAAC
AGTGGCTGGCATCATCCGGCTCAGTCAACCAGACCGTCCCGGTTGTACAGACCGATGAAGAATTACAGGC
GGCCAAGGCGTGCTTCGATGAAAACGGGCTGGAAGCCGCGCTGCGGTACCTGGAAAACCTGCCCGAAGGT
GATCCCCGCCACCAGTTTCACCGCCAGTTTTTCGGCGCGCAGTTACTGGAAGAGGCCGGTATGGTTCAGC
TTGCACAACAGCAGTACCGGATGCTCTTCAGAACAGGATTACACATGATGCTATCCGAATGGGAGCCTTC
CCTGCTGAAAGCACTGGAACAAAAACTCACGGCAGAACAGTAA

Protein ID: 700289658
SecReT6 ID937
T6SS typei1
Gene symbolevfE
Locus tagevfE
StrainEscherichia coli DE719
RepliconT6SS [GenBank: KM251715] [Browse all T6SS(s) in this replicon]
Location [Strand]5915..6346 [-]
ProductEvfE
NoteTssA
UniProt IDA0A097QQQ5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 143 a.a.     [Download]
>gi|700289658|ref|AIU68803.1| EvfE [Escherichia coli]
MADAIRDEVTDFLARLPALINLLFNDRTPFVSEQTKQWLASSGSVNQTVPVVQTDEELQAAKACFDENGL
EAALRYLENLPEGDPRHQFHRQFFGAQLLEEAGMVQLAQQQYRMLFRTGLHMMLSEWEPSLLKALEQKLT
AEQ
 
Nucleotide Sequence: 432 bp     [Download]
>gi|700289653|gb|KM251715|evfE|:5915-6346
GTGGCGGATGCTATCCGTGATGAAGTTACCGATTTTCTGGCCCGCCTGCCCGCACTGATCAACCTGTTGT
TTAACGACCGCACTCCGTTTGTGTCCGAACAGACGAAACAGTGGCTGGCATCATCCGGCTCAGTCAACCA
GACCGTCCCGGTTGTACAGACCGATGAAGAATTACAGGCGGCCAAGGCGTGCTTCGATGAAAACGGGCTG
GAAGCCGCGCTGCGGTACCTGGAAAACCTGCCCGAAGGTGATCCCCGCCACCAGTTTCACCGCCAGTTTT
TCGGCGCGCAGTTACTGGAAGAGGCCGGTATGGTTCAGCTTGCACAACAGCAGTACCGGATGCTCTTCAG
AACAGGATTACACATGATGCTATCCGAATGGGAGCCTTCCCTGCTGAAAGCACTGGAACAAAAACTCACG
GCAGAACAGTAA