SecReT6
Protein ID: 700289658
SecReT6 ID937
T6SS typei1
Gene symbolevfE
Locus tagevfE
StrainEscherichia coli DE719
RepliconT6SS [GenBank: KM251715] [Browse all T6SS(s) in this replicon]
Location [Strand]5915..6346 [-]
ProductEvfE
NoteTssA
UniProt IDA0A097QQQ5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 143 a.a.     [Download]
>gi|700289658|ref|AIU68803.1| EvfE [Escherichia coli]
MADAIRDEVTDFLARLPALINLLFNDRTPFVSEQTKQWLASSGSVNQTVPVVQTDEELQAAKACFDENGL
EAALRYLENLPEGDPRHQFHRQFFGAQLLEEAGMVQLAQQQYRMLFRTGLHMMLSEWEPSLLKALEQKLT
AEQ
 
Nucleotide Sequence: 432 bp     [Download]
>gi|700289653|gb|KM251715|evfE|:5915-6346
GTGGCGGATGCTATCCGTGATGAAGTTACCGATTTTCTGGCCCGCCTGCCCGCACTGATCAACCTGTTGT
TTAACGACCGCACTCCGTTTGTGTCCGAACAGACGAAACAGTGGCTGGCATCATCCGGCTCAGTCAACCA
GACCGTCCCGGTTGTACAGACCGATGAAGAATTACAGGCGGCCAAGGCGTGCTTCGATGAAAACGGGCTG
GAAGCCGCGCTGCGGTACCTGGAAAACCTGCCCGAAGGTGATCCCCGCCACCAGTTTCACCGCCAGTTTT
TCGGCGCGCAGTTACTGGAAGAGGCCGGTATGGTTCAGCTTGCACAACAGCAGTACCGGATGCTCTTCAG
AACAGGATTACACATGATGCTATCCGAATGGGAGCCTTCCCTGCTGAAAGCACTGGAACAAAAACTCACG
GCAGAACAGTAA