SecReT6
Protein ID: 700289661
SecReT6 ID937
T6SS typei1
Gene symbolevfH
Locus tagevfH
StrainEscherichia coli DE719
RepliconT6SS [GenBank: KM251715] [Browse all T6SS(s) in this replicon]
Location [Strand]8102..9160 [-]
ProductEvfH
NoteTssH
UniProt IDA0A097QQS9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.10E-39, Aligned region: 72..233
AAA_5 [PF07728], Evalue: 2.60E-12, Aligned region: 77..198
ClpB_D2-small [PF10431], Evalue: 5.80E-12, Aligned region: 239..315
AAA [PF00004], Evalue: 3.80E-08, Aligned region: 78..195
AAA_16 [PF13191], Evalue: 4.40E-05, Aligned region: 48..118
AAA_16 [PF13191], Evalue: 4.40E-05, Aligned region: 143..171
AAA_16 [PF13191], Evalue: 4.40E-05, Aligned region: 281..306
AAA_25 [PF13481], Evalue: 0.00098, Aligned region: 72..106
AAA_25 [PF13481], Evalue: 0.00098, Aligned region: 139..160
AAA_25 [PF13481], Evalue: 0.00098, Aligned region: 204..269
Protein Sequence: 352 a.a.     [Download]
>gi|700289661|ref|AIU68806.1| EvfH [Escherichia coli]
MLVSPHVDKKQIAAVIAEWTGVPLNRLSQNEMSVITDLPVWLGGTIKGQDLAIASLHKHLLTARADLRRP
GRPLGAFLLAGPSGVGKTETVLQLAELLYGGRQYLTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGVLTE
AIRQKPYSVVLLDEVEKAHPDVLNLFYQAFDKGEMADGEGRLIDCKNIVFFLTSNLGYQVIVEHADDPET
MQEALYPVLADFFKPALLARMEVVPYLPLSKETLATIIAGKLARLDNVLRSRFGADVIIGPEVTDEIMSR
VTRAENGARMLESVIDGDMLPPLSLLLLQKMAANTAIARIRLSAADGAFTADVEDALPDDAVTPQTEDET
VL
 
Nucleotide Sequence: 1059 bp     [Download]
>gi|700289653|gb|KM251715|evfH|:8102-9160
TTGCTGGTTTCCCCGCATGTCGATAAAAAACAGATTGCAGCGGTGATTGCTGAATGGACCGGCGTGCCGC
TTAACCGCCTGTCACAGAATGAGATGTCGGTCATCACCGACCTGCCGGTATGGCTCGGCGGCACCATCAA
GGGCCAGGACCTGGCGATTGCCAGCCTGCATAAACACCTGCTGACCGCACGCGCCGACCTGCGCCGTCCG
GGACGCCCGCTTGGTGCGTTCCTGCTGGCTGGCCCCAGCGGCGTGGGTAAAACCGAAACCGTCCTGCAAC
TGGCGGAACTGCTCTATGGCGGACGTCAATACCTGACCACCATCAATATGTCTGAGTTCCAGGAGAAACA
CACCGTTTCGCGGCTGATTGGCTCTCCTCCGGGTTATGTCGGCTACGGTGAAGGCGGCGTACTGACCGAA
GCGATTCGCCAGAAACCGTACTCGGTGGTGCTGCTCGATGAAGTAGAAAAAGCGCACCCGGATGTACTCA
ACCTGTTCTACCAGGCGTTTGACAAGGGCGAGATGGCAGACGGTGAAGGCCGCCTGATTGACTGTAAAAA
TATCGTTTTCTTCCTGACCTCCAACCTTGGCTACCAGGTGATTGTCGAACACGCCGATGACCCGGAAACC
ATGCAGGAAGCCCTCTATCCGGTGCTGGCGGACTTCTTTAAACCTGCTCTGCTGGCGCGCATGGAAGTGG
TGCCTTACCTACCGCTGTCGAAAGAGACGCTCGCTACCATTATTGCCGGGAAACTGGCCCGCCTGGATAA
CGTGCTGCGCAGCCGCTTTGGCGCGGACGTGATTATTGGGCCGGAAGTGACGGACGAAATCATGAGCCGC
GTCACCCGCGCGGAAAACGGCGCGAGGATGCTGGAATCGGTTATCGACGGCGACATGCTGCCGCCGCTCT
CGCTGCTGCTGTTGCAGAAAATGGCGGCCAACACGGCGATTGCCCGGATTCGCCTGTCGGCGGCAGACGG
TGCGTTCACGGCAGATGTGGAAGATGCGCTGCCTGATGATGCCGTGACACCGCAAACAGAGGACGAAACG
GTTTTATGA