SecReT6
Protein ID: 700289663
SecReT6 ID937
T6SS typei1
Gene symbolevfJ
Locus tagevfJ
StrainEscherichia coli DE719
RepliconT6SS [GenBank: KM251715] [Browse all T6SS(s) in this replicon]
Location [Strand]9716..10864 [-]
ProductEvfJ
NoteTssH
UniProt IDA0A097QQR0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA [PF00004], Evalue: 1.40E-07, Aligned region: 30..57
AAA [PF00004], Evalue: 1.40E-07, Aligned region: 221..332
AAA_16 [PF13191], Evalue: 0.00066, Aligned region: 131..152
AAA_16 [PF13191], Evalue: 0.00066, Aligned region: 198..237
AAA_16 [PF13191], Evalue: 0.00066, Aligned region: 263..298
AAA_22 [PF13401], Evalue: 0.00069, Aligned region: 219..305
Protein Sequence: 382 a.a.     [Download]
>gi|700289663|ref|AIU68808.1| EvfJ [Escherichia coli]
MIQIDLATLVKRLNPFAKQALEMAASECMSQQASEITVAHVLLQMLAIPRNDVRVIAERTGISAEDLRQA
LTVESYPGGRSAEGYPSFSPMLIEWLKESWLLASAQMQHSELRSGVLLLTLLHSPLRYIPPAAARLLTAI
NRDQLQQDFAAWTKESAESVDLAGGQTPRATETGDTLLARYAKNMTADARNGRLDPVLCRNYEIDLMIDI
LCRRRKNNPVVVGEAGVGKSALIEGLALRIVAGQVPDKLKNTDIMTLDLGALQAGASVKGEFEKRFKGLM
AEVIFSPVPVILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDAALSRRF
QLVKVSEPNAAEATIILRGLSAVYEQSHGSAD
 
Nucleotide Sequence: 1149 bp     [Download]
>gi|700289653|gb|KM251715|evfJ|:9716-10864
ATGATCCAGATTGATTTAGCCACGCTCGTAAAGCGGCTTAACCCCTTTGCAAAACAGGCGCTGGAAATGG
CTGCCTCGGAGTGTATGAGCCAGCAGGCCAGTGAGATCACCGTTGCCCATGTGCTGTTACAGATGCTGGC
AATCCCGCGCAACGACGTAAGGGTGATTGCCGAACGCACAGGCATCAGTGCGGAGGATTTACGCCAGGCG
CTGACCGTGGAGAGTTATCCCGGTGGACGTTCCGCCGAAGGCTATCCCAGCTTCTCCCCGATGCTGATCG
AATGGCTCAAGGAGTCATGGCTGCTGGCCTCAGCCCAGATGCAGCACAGCGAACTGCGCAGCGGCGTCCT
GCTGCTTACTCTGCTGCATTCACCGCTGCGCTATATTCCACCCGCTGCTGCCCGTCTGCTGACGGCCATA
AACCGCGACCAGTTACAGCAGGATTTCGCAGCATGGACAAAAGAATCCGCCGAATCCGTGGATCTGGCTG
GCGGGCAAACGCCCCGCGCAACGGAAACCGGCGACACCCTGCTTGCCCGCTACGCCAAAAACATGACCGC
AGACGCCCGTAACGGCAGGCTTGACCCGGTACTGTGCCGCAACTATGAAATCGACCTGATGATCGACATT
CTCTGCCGCCGCCGTAAAAACAATCCGGTGGTAGTGGGCGAAGCAGGCGTGGGTAAAAGCGCGCTGATTG
AAGGGCTGGCGCTGCGCATCGTGGCAGGCCAGGTGCCGGACAAGCTGAAAAACACCGATATCATGACCCT
TGACCTGGGCGCATTGCAGGCCGGTGCGTCGGTGAAAGGTGAGTTTGAAAAACGCTTCAAGGGGCTGATG
GCGGAGGTCATTTTCTCCCCGGTGCCGGTCATTCTGTTTATCGACGAAGCACATACCCTGATTGGCGCGG
GCAACCAGCAGGGCGGGCTGGATATATCCAACCTGCTCAAACCAGCGCTGGCGCGCGGCGAGCTGAAAAC
CATCGCCGCCACCACCTGGAGCGAGTACAAAAAATATTTCGAGAAAGATGCAGCTTTGTCGCGCCGCTTC
CAGTTAGTGAAGGTCAGCGAACCCAACGCTGCCGAAGCCACCATTATTCTGCGCGGTTTGTCGGCGGTCT
ATGAACAATCTCACGGCAGTGCTGATTGA