SecReT6
Protein ID: 700289666
SecReT6 ID937
T6SS typei1
Gene symbolevfM
Locus tagevfM
StrainEscherichia coli DE719
RepliconT6SS [GenBank: KM251715] [Browse all T6SS(s) in this replicon]
Location [Strand]12992..13516 [-]
ProductEvfM
NoteTssJ
UniProt IDQ6TKU4
KEGG IDelf:LF82_021
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 9.40E-32, Aligned region: 14..167
Protein Sequence: 174 a.a.     [Download]
>gi|700289666|ref|AIU68811.1| EvfM [Escherichia coli]
MNGKAFLACVLMSVVLTGCETAKKISQVIRNPDIQVGKLMDQSTELTVTLLTEPDSNLTADGEAAPVDVQ
LVYLSDDSKFHAADYDQVATTALPDVLGKNYIDHQDFNLLPDTVKTLPPIKLDEKTGYIGVIAYFSDDQA
TEWKQIESVESIGHHYRLLVHIRASAIEMKKEEN
 
Nucleotide Sequence: 525 bp     [Download]
>gi|700289653|gb|KM251715|evfM|:12992-13516
ATGAACGGCAAAGCGTTTCTGGCCTGCGTTCTGATGAGCGTCGTATTAACTGGCTGTGAAACAGCGAAAA
AAATCAGCCAGGTGATCCGCAATCCGGATATTCAGGTCGGAAAGCTGATGGATCAGTCAACCGAGCTGAC
CGTCACGCTGCTGACCGAGCCGGACAGCAACCTGACGGCGGATGGCGAAGCCGCGCCGGTGGATGTCCAG
TTGGTTTATCTGAGCGACGACTCAAAATTCCATGCCGCCGACTACGACCAGGTTGCCACCACCGCGCTGC
CCGACGTGCTGGGGAAAAACTATATCGATCACCAGGACTTCAACCTGTTGCCGGATACCGTAAAAACACT
GCCGCCGATCAAGTTGGATGAGAAAACCGGTTATATCGGTGTCATTGCCTATTTTTCAGACGACCAGGCC
ACAGAATGGAAACAAATTGAGTCGGTAGAAAGTATCGGCCACCACTATCGCCTGCTGGTGCATATCCGCG
CCAGTGCGATTGAGATGAAAAAAGAGGAAAACTGA