SecReT6
Protein ID: 700289667
SecReT6 ID937
T6SS typei1
Gene symbolevfN
Locus tagevfN
StrainEscherichia coli DE719
RepliconT6SS [GenBank: KM251715] [Browse all T6SS(s) in this replicon]
Location [Strand]13513..14121 [-]
ProductEvfN
NoteFha
UniProt IDA0A097QQS8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 202 a.a.     [Download]
>gi|700289667|ref|AIU68812.1| EvfN [Escherichia coli]
MNFLPWRSTTWPVTPLLRGMECPLTLHNSQDADEFLEEAGRALQAAIKGLLSLQQQQNSLSDKHLRPLED
NPLRLDMDYATALNVMFAEGKSPVHLAAPAAIAESLRNIRHHEEANRAAIVEALRVMLDAFSPGNLMRRF
AQYRRSHELRQKMDDAWAWQMYSNYYDELASSRQQGFEMLFNEVYAQVYDRVLREKQREPEA
 
Nucleotide Sequence: 609 bp     [Download]
>gi|700289653|gb|KM251715|evfN|:13513-14121
ATGAATTTTCTGCCATGGCGCAGTACCACCTGGCCTGTAACCCCGCTGCTGCGCGGTATGGAGTGTCCGC
TGACGCTGCACAATTCTCAGGATGCGGATGAGTTTCTCGAAGAGGCCGGACGGGCGTTGCAGGCCGCCAT
TAAGGGATTGCTGAGTCTGCAACAACAACAGAACAGCCTGTCGGATAAACACCTGCGTCCACTAGAAGAC
AACCCGTTGCGCCTTGATATGGACTATGCCACCGCGCTGAACGTCATGTTCGCCGAGGGTAAAAGCCCGG
TACATCTCGCAGCACCTGCGGCCATCGCCGAAAGCCTGCGCAACATCCGGCATCATGAAGAGGCTAACCG
GGCGGCGATTGTGGAAGCGTTGCGTGTCATGCTGGACGCCTTTTCGCCGGGCAACCTGATGCGCCGCTTT
GCGCAATACCGCCGCAGCCATGAACTGCGCCAGAAAATGGACGACGCCTGGGCATGGCAGATGTACAGCA
ACTATTACGATGAGCTGGCCTCCAGCCGACAGCAGGGATTTGAAATGCTGTTCAATGAAGTTTATGCCCA
GGTCTATGACCGGGTGCTGCGCGAAAAACAGCGGGAGCCGGAAGCATGA