SecReT6
Protein ID: 700289668
SecReT6 ID937
T6SS typei1
Gene symbolevfO
Locus tagevfO
StrainEscherichia coli DE719
RepliconT6SS [GenBank: KM251715] [Browse all T6SS(s) in this replicon]
Location [Strand]14021..14794 [-]
ProductEvfO
NoteFha
UniProt IDA0A097QQR5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 0.00095, Aligned region: 40..104
Protein Sequence: 257 a.a.     [Download]
>gi|700289668|ref|AIU68813.1| EvfO [Escherichia coli]
MAEEKQQSRQASLTLQVMNGNELESGRAAKCLFSENGGDIGHTPECHWQVQDRAGSIAARACTVIRHDGA
YCLRCLTPGLMINLAPASSDALIRLRQGDEIQLGALALKVFLHDGAAVTYDERMATPETIVMNRDSLADT
LLTTEGQPAYPGMPFQHQLAPTVAHGFSSDPLQALQTESLMVADDPIAPRVSRPVAPASDLTGANGINTP
FMDLPPGNARHEDGDEFSAMAQYHLACNPAAARYGVSADAAQFSGCG
 
Nucleotide Sequence: 774 bp     [Download]
>gi|700289653|gb|KM251715|evfO|:14021-14794
ATGGCTGAGGAAAAACAGCAATCCCGCCAGGCCTCACTGACTTTACAGGTGATGAATGGCAACGAACTGG
AAAGCGGACGCGCCGCAAAATGCCTGTTCAGCGAAAACGGCGGTGATATTGGCCATACGCCGGAATGTCA
CTGGCAGGTACAGGACCGGGCGGGAAGCATTGCTGCGCGTGCCTGTACCGTTATCCGGCACGACGGAGCC
TATTGCCTGCGGTGCCTGACGCCGGGACTGATGATTAATCTGGCCCCGGCCTCTTCCGATGCGCTCATCC
GCCTGCGCCAGGGGGATGAGATCCAGCTCGGCGCACTGGCGCTGAAAGTGTTTCTGCATGACGGTGCAGC
TGTTACCTATGACGAGCGGATGGCGACCCCGGAAACGATTGTAATGAACCGCGACAGTCTGGCGGACACC
CTGCTGACCACCGAGGGACAACCGGCGTATCCGGGAATGCCGTTCCAGCATCAGCTTGCCCCCACGGTGG
CGCACGGTTTTTCCAGCGATCCGCTCCAGGCACTCCAGACGGAAAGCCTGATGGTGGCAGATGATCCGAT
CGCCCCACGCGTTTCCCGGCCCGTAGCCCCCGCATCCGATCTGACAGGTGCAAACGGGATCAACACGCCG
TTTATGGATCTGCCGCCCGGCAATGCCCGTCATGAGGACGGCGATGAATTTTCTGCCATGGCGCAGTACC
ACCTGGCCTGTAACCCCGCTGCTGCGCGGTATGGAGTGTCCGCTGACGCTGCACAATTCTCAGGATGCGG
ATGA