SecReT6
Protein ID: 700289673
SecReT6 ID937
T6SS typei1
Gene symbolevfT
Locus tagevfT
StrainEscherichia coli DE719
RepliconT6SS [GenBank: KM251715] [Browse all T6SS(s) in this replicon]
Location [Strand]19119..19586 [-]
ProductEvfT
NoteTssC
UniProt IDA0A097QQS1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.30E-28, Aligned region: 67..152
Protein Sequence: 155 a.a.     [Download]
>gi|700289673|ref|AIU68818.1| EvfT [Escherichia coli]
MSVKEEIAPVSASQTAAPPSLLDEIMAQTRVQPKSESYDITRQGVSAFIAAMLQGDSSAEPINILAVDAM
IADIDARTSRQMDAIIHAPEFQELESLLRSLKLLVERADTRENIKVHFLNVTQEELLDDFEFAPEITQSA
YYKHVYSSGYRTIWR
 
Nucleotide Sequence: 468 bp     [Download]
>gi|700289653|gb|KM251715|evfT|:19119-19586
ATGTCAGTAAAGGAAGAAATTGCTCCCGTCAGCGCGTCTCAAACCGCCGCGCCCCCATCTCTGCTTGATG
AAATCATGGCGCAAACCCGCGTCCAGCCTAAATCAGAAAGCTACGATATCACCCGCCAGGGCGTGAGCGC
CTTTATTGCCGCCATGTTACAGGGCGACAGTAGCGCTGAACCTATCAATATCCTGGCCGTTGACGCCATG
ATTGCTGATATTGATGCCCGAACCAGCAGGCAGATGGATGCCATTATTCATGCCCCGGAGTTTCAGGAAC
TGGAATCCCTGCTGCGCTCGCTGAAGCTGCTGGTTGAACGCGCGGATACACGGGAAAACATCAAAGTCCA
TTTCCTGAATGTCACTCAGGAAGAACTGCTGGATGATTTCGAATTTGCACCTGAAATCACGCAGTCTGCG
TATTACAAGCATGTATATTCAAGCGGTTACCGGACAATTTGGCGGTGA