SecReT6
Protein ID: 700289674
SecReT6 ID937
T6SS typei1
Gene symbolevfU
Locus tagevfU
StrainEscherichia coli DE719
RepliconT6SS [GenBank: KM251715] [Browse all T6SS(s) in this replicon]
Location [Strand]19609..20112 [-]
ProductEvfU
NoteTssB
UniProt IDQ6TKV1
KEGG IDelf:LF82_027
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.40E-48, Aligned region: 10..162
Protein Sequence: 167 a.a.     [Download]
>gi|700289674|ref|AIU68819.1| EvfU [Escherichia coli]
MSKMNNNGGSVAPKERISVRYTPKVDGVAADIELPLNLLITGNLKGKPDNTPLDERTAIAINRYNLNAVI
SEADIEREFVVPAELSDAPNEQMYVNLKVKSMDDLSPDHIASQVPEIKRLLELREALVALKSPLGNIPAF
RAQLQALLENEDTREQLIQELGIAVQK
 
Nucleotide Sequence: 504 bp     [Download]
>gi|700289653|gb|KM251715|evfU|:19609-20112
ATGAGCAAAATGAACAACAATGGCGGCAGTGTCGCGCCGAAAGAAAGAATCAGCGTTCGGTATACACCAA
AAGTTGATGGGGTGGCTGCTGATATCGAATTGCCGCTGAATTTATTGATCACCGGCAATCTGAAAGGGAA
ACCAGATAACACGCCGTTGGATGAGCGAACTGCCATTGCTATCAACCGCTATAACCTCAACGCAGTCATT
TCAGAAGCTGACATTGAACGGGAGTTTGTTGTTCCGGCTGAACTCAGTGACGCTCCCAATGAGCAAATGT
ACGTCAACCTGAAAGTCAAATCTATGGATGACCTTTCTCCTGACCATATTGCCAGCCAGGTACCAGAAAT
AAAACGTCTGCTCGAATTGCGTGAAGCCCTAGTCGCACTTAAGTCTCCACTAGGCAATATTCCAGCCTTC
CGCGCACAACTTCAGGCGCTACTGGAAAACGAAGACACCCGCGAGCAGCTGATCCAGGAACTGGGTATCG
CCGTTCAGAAATAA