SecReT6
Protein ID: 700289676
SecReT6 ID937
T6SS typei1
Gene symbolevfW
Locus tagevfW
StrainEscherichia coli DE719
RepliconT6SS [GenBank: KM251715] [Browse all T6SS(s) in this replicon]
Location [Strand]21557..23539 [+]
ProductEvfW
NoteTssI
UniProt IDQ6TKV3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 9.00E-64, Aligned region: 34..328
Phage_base_V [PF04717], Evalue: 1.30E-26, Aligned region: 367..459
Gp5_C [PF06715], Evalue: 6.20E-05, Aligned region: 501..523
Gp5_C [PF06715], Evalue: 6.20E-05, Aligned region: 516..539
Gp5_C [PF06715], Evalue: 6.20E-05, Aligned region: 546..563
Gp5_C [PF06715], Evalue: 6.20E-05, Aligned region: 567..584
Protein Sequence: 660 a.a.     [Download]
>gi|700289676|ref|AIU68821.1| EvfW [Escherichia coli]
MSLKGLRFTLEVDGQEPDTFAVVNFRLIQNQSYPFVMSVDVASDSFMQTAEMLLEKNATLTIWQGVIPLR
YVTGVVAGFGMQENNGWQMRYHLRIEPPLWRCGLRRNFRIFQQQDIRTISATLLNENGVTEWTPLFYEDH
PAREFCVQYGESDLAFLARLWAEEGIFFFERFAADSPEQKLTLCDDVAGLSQAGELPFNPDTSAGAETEC
VSMFRYEAHVRPSSVQSQDYTFKVPDWPGMYEQQGESLNGQLEQYEIFDYPGRYKDEQHGKDFTLYRMES
LRSDAEKATGQSNSPKLWPGTWFTLTGHPQKMLNREWQVVQSILSGDQPQALHGSQGRGTTLGNQLEVIP
ADRTWRPRLQSKPKVDGPQSAIVTGPAGEEIFCDEHGRVRVKFHWDRYNPATEASSCWVRVSQAWAGPGF
GNLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHEDNRSPGSLPGTKTQMTIRSKTYKGSGFNELRFEDATG
GEQVYIHAQKNMDTEVLNNRTTDVKADHTETIGNDQKITVGLGQTVNVGSKKEGGHDQKVTVANDQHLTI
KNDRHKVVNNNQTSKVTGTDTEEVVKKQSIKIGDNYELKVEHGTNIISGDSIELICGQGESGTCSIKLEK
TGKIIIRGTEFLFEATGPVDIKGKDIHLNG
 
Nucleotide Sequence: 1983 bp     [Download]
>gi|700289653|gb|KM251715|evfW|:21557-23539
ATGTCCTTAAAAGGTCTTCGCTTTACGCTGGAGGTTGACGGCCAGGAGCCGGACACCTTTGCAGTGGTGA
ATTTCCGGTTAATCCAGAACCAGTCTTATCCGTTTGTGATGAGTGTGGATGTCGCCAGCGATTCTTTTAT
GCAGACGGCGGAGATGCTGCTGGAGAAGAACGCAACGCTGACTATCTGGCAGGGTGTCATCCCGCTGCGT
TATGTCACCGGCGTGGTGGCGGGCTTTGGCATGCAGGAGAACAACGGCTGGCAGATGCGTTATCACCTGC
GTATTGAGCCGCCGTTATGGCGGTGCGGGCTGCGGCGGAACTTCCGTATCTTCCAGCAGCAGGATATCCG
GACGATATCGGCCACATTACTGAACGAGAACGGCGTCACAGAGTGGACGCCGCTGTTTTATGAGGACCAT
CCGGCGCGGGAGTTCTGTGTGCAGTACGGGGAGTCGGACCTGGCGTTTCTGGCGCGGCTGTGGGCGGAGG
AGGGGATTTTCTTCTTTGAGCGGTTTGCGGCGGACAGTCCGGAGCAGAAGCTGACGCTGTGCGACGATGT
GGCGGGGCTGTCACAGGCGGGGGAGCTTCCGTTTAACCCGGACACATCGGCAGGAGCGGAGACGGAGTGT
GTCAGTATGTTCCGTTATGAGGCGCATGTCCGCCCGTCATCGGTGCAGAGCCAGGATTACACGTTTAAGG
TGCCGGACTGGCCGGGGATGTATGAGCAGCAGGGTGAGAGCCTGAACGGACAGCTTGAACAGTATGAAAT
ATTTGATTATCCGGGAAGGTACAAGGATGAACAGCACGGCAAGGATTTCACGCTGTACCGGATGGAGAGC
CTGCGCAGTGATGCGGAAAAGGCCACAGGGCAGAGTAATTCGCCGAAGCTGTGGCCGGGGACGTGGTTTA
CGCTGACGGGGCATCCGCAGAAGATGCTGAACCGTGAATGGCAGGTGGTACAGAGCATTCTGTCAGGAGA
CCAGCCGCAGGCGCTTCACGGCAGCCAGGGGAGAGGAACCACGCTGGGAAATCAGTTAGAGGTGATACCG
GCGGACCGGACGTGGCGTCCACGGCTGCAAAGCAAACCGAAGGTGGACGGGCCACAGAGCGCCATTGTCA
CCGGGCCTGCGGGAGAGGAAATCTTCTGTGATGAACATGGCCGGGTACGGGTGAAGTTTCACTGGGACAG
GTATAACCCGGCAACGGAGGCGAGTTCGTGCTGGGTGAGGGTGTCACAGGCGTGGGCGGGGCCGGGGTTT
GGTAACCTGGCGATACCGCGCGTGGGCCAGGAGGTGATTGTTGACTTCCTGAACGGGGACCCGGACCAGC
CGATAATCATGGGGCGGACGTACCATGAGGACAACCGTTCGCCGGGGAGCCTGCCGGGGACGAAGACGCA
GATGACGATACGGTCGAAGACCTATAAAGGAAGCGGCTTTAATGAACTGCGGTTTGAAGACGCCACGGGC
GGTGAACAGGTCTATATCCACGCGCAGAAGAACATGGATACGGAGGTGCTGAATAATCGGACGACGGATG
TGAAGGCTGACCACACGGAGACCATTGGTAACGACCAGAAGATAACGGTGGGGTTGGGCCAGACGGTGAA
TGTGGGGAGCAAAAAGGAAGGTGGTCATGACCAGAAAGTGACGGTAGCGAACGATCAGCATCTCACGATA
AAAAATGACCGGCACAAGGTTGTAAATAACAACCAGACAAGCAAGGTGACGGGAACTGATACCGAAGAAG
TCGTCAAAAAACAGAGTATTAAAATAGGTGATAATTACGAACTGAAAGTTGAGCATGGTACAAATATCAT
ATCTGGGGACAGTATTGAGCTAATTTGTGGGCAGGGAGAGAGCGGGACTTGTTCCATAAAACTGGAGAAA
ACAGGAAAGATAATAATACGGGGGACGGAGTTTCTATTTGAGGCTACCGGTCCTGTAGATATTAAAGGAA
AAGATATTCATCTGAACGGATAG