SecReT6
Protein ID: 70733363
SecReT6 ID35
T6SS typei3
Gene symboltagF
Locus tagPFL_6080
StrainPseudomonas protegens Pf-5
Repliconchromosome [GenBank: NC_004129] [Browse all T6SS(s) in this replicon]
Location [Strand]6903659..6904312 [-]
Producttype VI secretion-associated protein TagF
NoteTagF
UniProt IDQ4K3P5
KEGG IDpfl:PFL_6080
PDB IDNA
Domain hit(s) vs Pfam DUF2094 [PF09867], Evalue: 1.80E-50, Aligned region: 5..142
Protein Sequence: 217 a.a.     [Download]
>gi|70733363|ref|YP_263138.1| tagF gene product [Pseudomonas fluorescens Pf-5]
MTAPGLYGKLASRGDFVSRGLPQSFIGPWDSWLAAGLLASQNALGEQWLNAYLISPLWRFALAPGVCGPQ
AAVGVVMPSIDRVGRYFPLTVAALLEPEADLASLVGGPEQWFEQVEELLLATLEEGASFEALEEGLQALG
APSPASRIEGSHYAGLQRFYVSDPQARGAVLAAQACAGSSAWWGRGSQYISPMLLRCQGLPPASEFAQFL
LGQEGAV
 
Nucleotide Sequence: 654 bp     [Download]
>gi|70728250|ref|NC_004129.6|:c6904312-6903659 Pseudomonas fluorescens Pf-5 chromosome, complete genome
ATGACGGCGCCGGGCCTGTACGGCAAGTTGGCCAGCCGTGGCGATTTTGTCAGCCGTGGCCTGCCGCAGA
GTTTCATCGGCCCCTGGGACAGTTGGCTGGCGGCGGGGCTGCTGGCCAGCCAGAACGCCCTGGGCGAGCA
GTGGCTGAACGCCTACCTGATCAGCCCGTTGTGGCGCTTCGCCCTGGCCCCCGGGGTCTGCGGGCCCCAG
GCGGCGGTCGGGGTGGTGATGCCGAGCATCGACCGCGTGGGGCGCTATTTCCCCCTGACCGTGGCTGCGC
TGCTGGAGCCCGAGGCCGACCTGGCTTCGTTGGTCGGCGGCCCGGAGCAGTGGTTCGAACAGGTGGAAGA
GCTGTTGCTGGCGACCCTGGAAGAGGGCGCCAGTTTCGAAGCCCTGGAAGAGGGCTTGCAGGCCCTGGGC
GCGCCAAGCCCGGCCAGCCGGATCGAAGGCAGCCACTACGCCGGCCTGCAGCGGTTTTACGTCAGCGATC
CACAGGCCCGGGGCGCGGTACTCGCGGCCCAGGCCTGCGCGGGATCGAGTGCCTGGTGGGGGCGCGGTTC
GCAGTACATCAGCCCAATGCTGTTGCGCTGCCAGGGCTTGCCGCCGGCCAGTGAATTTGCGCAATTTTTG
CTCGGACAAGAGGGTGCCGTCTAA