SecReT6
Protein ID: 70733365
SecReT6 ID35
T6SS typei3
Gene symboltssL
Locus tagPFL_6082
StrainPseudomonas protegens Pf-5
Repliconchromosome [GenBank: NC_004129] [Browse all T6SS(s) in this replicon]
Location [Strand]6907812..6909137 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ4K3P3
KEGG IDpfl:PFL_6082
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.00E-70, Aligned region: 58..263
OmpA [PF00691], Evalue: 3.40E-16, Aligned region: 331..429
DUF883 [PF05957], Evalue: 0.00039, Aligned region: 76..131
DUF883 [PF05957], Evalue: 0.00039, Aligned region: 195..260
DUF883 [PF05957], Evalue: 0.00039, Aligned region: 328..363
Protein Sequence: 441 a.a.     [Download]
>gi|70733365|ref|YP_263140.1| tssL gene product [Pseudomonas fluorescens Pf-5]
MHPFDDSPGQPSPPNDRTQFMPRPGGRAPEPGRPAAAPAPSLAMPAAPLPAGQARGLNPLESAAGPLLAL
LTRLRSTLAHPAPASLRAQLLAYLRQFEERAEAAGVPRNDVLLARYALCTALDEAVLSTPWGSTSDWGKQ
SLLITVHNEAWGGEKVFQLLEHCLQSPRERLYLLELLYLCMCLGFEGRYRVMIDGRSQLEALRERTAATI
RSARGEHERELSPHWRGVTVARDRLAQFMPPWVGIAIGVALLLALLFGLRLKLAADAEPVFKNIHALGEI
PVQTLDRPVIQPKIVERPRLAGFLAEDIKAGRVAVEDAVDRSVVTIRGDELFASASASILDDYQPLMLRI
ADAVRKVKGQVRITGHSDNRPIATLRFPSNWKLSQARAESVLQILAAKTGQPERFSAEGRSDTEPLATNA
TAEGRARNRRVEISVLAEGVE
 
Nucleotide Sequence: 1326 bp     [Download]
>gi|70728250|ref|NC_004129.6|:c6909137-6907812 Pseudomonas fluorescens Pf-5 chromosome, complete genome
ATGCATCCTTTCGACGATTCGCCAGGGCAGCCGTCCCCGCCCAACGACCGTACCCAATTCATGCCGCGCC
CCGGTGGCCGTGCTCCCGAGCCCGGGCGCCCAGCTGCTGCGCCCGCGCCGTCGTTGGCCATGCCGGCGGC
GCCGCTGCCGGCCGGCCAGGCCCGTGGCCTGAACCCCCTGGAAAGCGCCGCGGGCCCACTGCTGGCCTTG
CTCACAAGGCTGCGCAGCACCCTGGCGCACCCGGCGCCGGCCAGCCTGCGGGCGCAACTGCTGGCCTACC
TGCGCCAGTTCGAGGAGCGCGCGGAAGCCGCCGGCGTGCCGCGCAACGACGTGCTGCTGGCGCGCTATGC
GCTCTGTACTGCCCTGGATGAAGCCGTGCTGAGCACGCCCTGGGGCAGCACCAGCGACTGGGGCAAGCAG
AGCCTGCTGATCACCGTGCACAACGAGGCCTGGGGCGGCGAGAAGGTCTTCCAGCTGCTGGAGCACTGCC
TGCAAAGCCCGCGCGAGCGCCTGTACCTGCTGGAGCTGTTGTACCTGTGCATGTGCCTGGGTTTCGAAGG
CCGCTACCGGGTGATGATCGATGGTCGCAGCCAGCTCGAGGCCCTGCGCGAGCGCACCGCGGCCACCATC
CGCAGCGCCCGTGGCGAGCACGAGCGCGAGCTGTCGCCACACTGGCGCGGGGTCACCGTGGCCCGTGACC
GGCTGGCCCAGTTCATGCCGCCCTGGGTCGGCATCGCCATCGGCGTGGCCCTGCTCCTGGCGCTGCTGTT
CGGCCTGCGCCTGAAACTGGCGGCGGACGCCGAGCCGGTGTTCAAGAACATCCATGCCCTGGGCGAGATC
CCGGTGCAGACCCTGGACCGCCCGGTGATCCAGCCGAAGATTGTCGAGCGTCCGCGCCTGGCGGGCTTCC
TCGCCGAGGACATCAAGGCCGGGCGGGTGGCGGTGGAAGATGCCGTCGACCGTTCGGTGGTGACCATCCG
TGGCGACGAGCTGTTCGCCTCGGCCAGCGCCAGCATCCTCGACGACTACCAGCCGCTGATGCTGCGCATC
GCCGACGCCGTGCGCAAGGTCAAGGGCCAGGTACGGATCACCGGCCACAGCGACAACCGACCGATCGCCA
CCTTGCGCTTCCCGTCCAACTGGAAGCTGTCCCAGGCGCGCGCCGAATCGGTGTTGCAGATCCTCGCGGC
GAAGACCGGGCAGCCGGAGCGCTTCAGCGCCGAAGGCCGCAGCGACACCGAGCCACTGGCAACCAATGCC
ACCGCCGAAGGGCGGGCACGTAATCGTCGGGTAGAAATCAGCGTATTGGCGGAGGGGGTCGAGTGA