SecReT6
Protein ID: 70733366
SecReT6 ID35
T6SS typei3
Gene symboltssK
Locus tagPFL_6083
StrainPseudomonas protegens Pf-5
Repliconchromosome [GenBank: NC_004129] [Browse all T6SS(s) in this replicon]
Location [Strand]6909144..6910478 [-]
Producttype VI secretion protein TssK
NoteTssK
UniProt IDQ4K3P2
KEGG IDpfl:PFL_6083
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.80E-157, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|70733366|ref|YP_263141.1| tssK gene product [Pseudomonas fluorescens Pf-5]
MSWNNRVVWSEGMFIGTQHFQQHDRYLENLIDARSRPLSTGAWGFSELRIDQGLLAQGKLAIVSARGLLP
DGTPFNIPHDDLAPSPLCIDDNLRDGLVYLALPLKRAGARDTVDEGEELGGARYLSQVREVRDDNAPFEN
RAPVAVGSRALRLLTAQDGLSDYAAIGVVRVKEKRADRALVLDDSYIPPVLDVAASKPLSAFRSELLGLL
HQRGEALAGRVVASGAGGASEIADFMLLQLVNRAQPLVNHLSQISPLHPERLFSELVSLAGEFSTFTHSA
RRPEQYPQYQHDELAMSFAPVMQALREALSMLIDSKATPIPIVEKAYGVHVAMLADRTLLENASFILVVR
ADVPGETLRGRFAQQSKVGSVEHIRDLVNLQLPGIGLLPLPVAPRQLPYHAGSTYYELDRGSEHWKQLVH
SGGFAFHVAGEFPGLNLAFWAIRG
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|70728250|ref|NC_004129.6|:c6910478-6909144 Pseudomonas fluorescens Pf-5 chromosome, complete genome
ATGTCCTGGAACAATCGCGTGGTCTGGTCGGAAGGCATGTTCATTGGAACCCAGCACTTCCAGCAGCATG
ACCGTTACCTGGAAAACCTCATCGACGCCCGCAGCCGCCCGCTGTCGACGGGAGCCTGGGGGTTCTCCGA
GCTGCGTATCGATCAGGGCCTGCTGGCCCAGGGCAAGCTGGCCATCGTCAGCGCCCGTGGCCTGCTGCCC
GACGGCACGCCGTTCAACATTCCCCATGACGACCTGGCGCCCAGCCCGTTGTGCATCGACGACAACCTGC
GTGACGGCCTGGTGTACCTGGCGCTGCCCCTCAAGCGCGCCGGCGCCCGGGACACCGTGGACGAGGGCGA
AGAGCTGGGCGGTGCCCGCTACCTGAGCCAGGTGCGCGAGGTGCGTGACGACAACGCACCGTTCGAGAAC
CGCGCGCCGGTGGCCGTGGGCTCTCGGGCCCTGCGCCTGCTCACCGCCCAGGACGGCCTCAGCGACTACG
CCGCCATTGGCGTGGTGCGGGTCAAGGAGAAACGCGCCGACCGTGCTCTGGTGCTGGACGACAGCTACAT
TCCGCCGGTGCTGGACGTGGCCGCGTCCAAGCCGTTGAGCGCCTTTCGCAGCGAGCTGCTGGGCCTGCTG
CACCAGCGCGGCGAAGCCCTGGCCGGGCGCGTGGTGGCATCGGGCGCGGGGGGCGCTTCGGAAATCGCCG
ACTTCATGCTCCTGCAACTGGTGAACCGCGCCCAGCCCCTGGTCAACCACCTGAGCCAGATCAGCCCGCT
GCACCCCGAGCGCCTGTTCAGCGAGCTGGTGAGCCTGGCCGGCGAGTTCTCGACCTTCACCCACAGCGCC
CGGCGCCCTGAGCAATACCCGCAGTACCAGCACGATGAGCTGGCCATGAGTTTCGCCCCGGTGATGCAGG
CCCTGCGTGAAGCGCTGTCGATGCTGATCGACAGCAAGGCAACGCCGATCCCCATCGTCGAGAAAGCCTA
CGGCGTACACGTGGCGATGCTGGCCGACCGCACCCTGCTGGAGAACGCCAGCTTCATCCTGGTGGTGCGT
GCCGACGTGCCGGGCGAAACCCTGCGCGGGCGCTTCGCCCAGCAGAGCAAGGTGGGTTCGGTGGAGCACA
TCCGCGACCTGGTCAACCTGCAGCTGCCGGGCATCGGCCTGCTGCCGCTGCCGGTGGCGCCGCGGCAACT
GCCGTACCACGCAGGCTCGACCTACTACGAGCTGGACCGTGGCAGCGAGCACTGGAAACAACTGGTTCAC
TCCGGCGGCTTCGCGTTCCACGTCGCGGGAGAATTCCCGGGCTTGAACCTGGCCTTCTGGGCCATTCGAG
GATAA