SecReT6
Protein ID: 70733367
SecReT6 ID35
T6SS typei3
Gene symboltssJ
Locus tagPFL_6084
StrainPseudomonas protegens Pf-5
Repliconchromosome [GenBank: NC_004129] [Browse all T6SS(s) in this replicon]
Location [Strand]6910494..6911000 [-]
Producttype VI secretion lipoprotein TssJ
NoteTssJ
UniProt IDQ4K3P1
KEGG IDpfl:PFL_6084
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 6.80E-35, Aligned region: 11..152
Protein Sequence: 168 a.a.     [Download]
>gi|70733367|ref|YP_263142.1| tssJ gene product [Pseudomonas fluorescens Pf-5]
MIQRLLTLVAMLVLAACAKDTPPPGEPAKEAPGATTVELHFQAVSGLNPGPDGQSTPVRVRIFELKNPAT
FMRADYFALAERAPATLGPDLIDQDEVLVKPGDQFTLKRTLDPATRQVGLLVGYREVDQALWRVGVNTAQ
RLSNQYQIVLDVRAVSAELVASPSSPAQ
 
Nucleotide Sequence: 507 bp     [Download]
>gi|70728250|ref|NC_004129.6|:c6911000-6910494 Pseudomonas fluorescens Pf-5 chromosome, complete genome
ATGATTCAACGATTGCTGACATTGGTTGCCATGCTGGTACTGGCGGCCTGTGCCAAGGACACACCACCTC
CCGGCGAACCGGCCAAGGAAGCGCCCGGCGCCACGACTGTGGAGCTGCATTTCCAGGCGGTCAGCGGGCT
CAACCCCGGGCCTGATGGCCAGAGCACGCCGGTGCGGGTACGGATCTTCGAGCTGAAGAATCCGGCCACC
TTCATGCGCGCCGACTACTTCGCCCTGGCGGAGCGGGCGCCGGCTACCCTCGGCCCGGACCTGATCGACC
AGGATGAAGTGCTGGTCAAGCCCGGCGACCAGTTCACCCTCAAGCGCACCCTGGACCCGGCCACCCGTCA
GGTCGGCCTGCTGGTGGGCTATCGCGAAGTGGACCAGGCCCTGTGGCGGGTCGGGGTCAACACCGCGCAG
CGCCTGAGCAACCAATATCAGATCGTCCTCGACGTCCGCGCGGTCAGCGCCGAGCTCGTGGCATCCCCAT
CCAGCCCTGCCCAATAG