SecReT6
Protein ID: 70733368
SecReT6 ID35
T6SS typei3
Gene symbolfha
Locus tagPFL_6085
StrainPseudomonas protegens Pf-5
Repliconchromosome [GenBank: NC_004129] [Browse all T6SS(s) in this replicon]
Location [Strand]6911065..6912549 [-]
Producttype VI secretion protein Fha
NoteFha
UniProt IDQ4K3P0
KEGG IDpfl:PFL_6085
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.60E-14, Aligned region: 30..97
Protein Sequence: 494 a.a.     [Download]
>gi|70733368|ref|YP_263143.1| fha gene product [Pseudomonas fluorescens Pf-5]
MSLCLTITSYHKITPGQCPEKLMDQGMMAIGRSSDNDWVLPDPERLVSARHCVIQYKDGRYYLTDNSTNG
VELVRAGIRMRRGSSEPLEDGEVIRIGDYEISARIDFSLNRPGAEPFSGDSSNSFEALMGRQAASPTPIE
PISMAPVAHFQGASAQDTFPDLFDFLAPSATPPATQPDHVPAEQHDFRPPTPTAVPQPVAPPEPSAPQGG
AVIPEDWDLFGSTPASPAPVPSAPPVVAPPVVAAAPIAHQASFAAEPAQPQPQPQPQPQPIAQAPVAPVV
SEVELAPVVTPAPAPVAPQGDLLQAFLRGAGLDQLRIEPQQAQAQMESLGRSYRLMVEGLIDVLRARSSL
KGEFRMQQTMIRPVENNPLKFAPNVDEAMLLLLRHSNQAFMAPDQAVQDSFDDLRAHQLAVMAGVEAAIK
HLLGRFEPTELEARMARPGGLGNLFSGSRQAQNWQQFTALYKQISQEAQDDFQDLFGREFSRAYEEHTHR
LRRS
 
Nucleotide Sequence: 1485 bp     [Download]
>gi|70728250|ref|NC_004129.6|:c6912549-6911065 Pseudomonas fluorescens Pf-5 chromosome, complete genome
ATGTCGCTGTGTTTGACTATCACTAGTTATCACAAGATTACCCCTGGTCAATGCCCTGAAAAACTAATGG
ACCAGGGAATGATGGCAATTGGCCGCAGTTCCGATAATGACTGGGTACTTCCTGATCCCGAACGCTTAGT
TTCCGCGCGGCACTGTGTCATCCAATACAAGGATGGCCGTTATTATTTGACCGATAACAGTACTAATGGT
GTGGAGTTAGTCCGTGCCGGTATTCGTATGCGCCGGGGTAGCAGCGAGCCTCTGGAAGATGGCGAGGTTA
TTCGCATTGGCGATTATGAAATCAGTGCGCGCATCGATTTCAGTCTGAACCGCCCGGGGGCTGAACCCTT
TTCCGGGGACAGCTCCAATAGTTTCGAGGCGCTGATGGGGCGTCAGGCGGCTTCGCCGACCCCCATCGAA
CCGATTTCCATGGCCCCGGTGGCGCACTTCCAGGGTGCCTCGGCCCAGGACACCTTTCCCGATCTGTTCG
ACTTTCTCGCCCCCAGCGCGACCCCGCCGGCCACCCAACCGGACCACGTGCCGGCCGAGCAGCACGATTT
TCGCCCGCCGACCCCCACCGCGGTGCCCCAGCCCGTGGCACCGCCTGAGCCATCGGCGCCCCAGGGCGGG
GCGGTGATTCCGGAGGACTGGGACCTGTTCGGCTCGACGCCCGCAAGCCCTGCGCCAGTGCCCAGTGCGC
CGCCCGTGGTTGCCCCGCCGGTGGTTGCCGCCGCGCCGATTGCCCACCAGGCCTCGTTCGCGGCAGAACC
CGCGCAGCCGCAGCCGCAGCCGCAGCCGCAGCCGCAGCCGATCGCCCAGGCGCCCGTGGCACCGGTGGTT
TCCGAAGTGGAGCTGGCTCCTGTTGTCACGCCCGCGCCGGCCCCGGTCGCCCCCCAGGGGGATCTGCTCC
AGGCCTTCCTGCGCGGGGCCGGGCTCGATCAACTGCGTATCGAGCCGCAGCAGGCCCAGGCCCAGATGGA
AAGCCTGGGTCGCAGCTACCGGTTGATGGTCGAGGGCCTGATCGATGTATTGCGTGCCCGTAGCAGCCTC
AAGGGCGAGTTCCGCATGCAGCAGACGATGATCCGCCCGGTGGAAAACAACCCGCTGAAGTTCGCCCCCA
ATGTGGACGAGGCCATGCTCCTGCTGCTGCGCCACAGCAACCAGGCATTCATGGCTCCGGATCAGGCCGT
GCAGGACAGTTTCGATGACCTGCGGGCGCACCAGCTGGCGGTCATGGCCGGTGTGGAAGCGGCCATCAAG
CACCTGCTGGGGCGCTTCGAGCCCACTGAACTGGAAGCTCGCATGGCTCGCCCCGGCGGCCTGGGCAATC
TGTTCAGCGGCTCGCGCCAGGCGCAGAACTGGCAGCAGTTCACTGCACTCTACAAACAGATTTCCCAAGA
GGCCCAGGACGATTTCCAGGACCTCTTCGGTCGTGAGTTCAGCCGCGCCTATGAAGAACACACCCACCGG
CTGCGCCGTTCCTGA