SecReT6
Protein ID: 70733370
SecReT6 ID35
T6SS typei3
Gene symboltssB
Locus tagPFL_6087
StrainPseudomonas protegens Pf-5
Repliconchromosome [GenBank: NC_004129] [Browse all T6SS(s) in this replicon]
Location [Strand]6914043..6914558 [+]
Producttype VI secretion protein TssB
NoteTssB
UniProt IDQ4K3N8
KEGG IDpfl:PFL_6087
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.80E-59, Aligned region: 10..163
Protein Sequence: 171 a.a.     [Download]
>gi|70733370|ref|YP_263145.1| tssB gene product [Pseudomonas fluorescens Pf-5]
MAKQSSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVMADLAGKPVEPLAAVADRKFLEIDVDNFD
SRLKAMQPRVAFHVPNELTGEGNLSLDITFESMDDFSPAAVARKVDSLNQLLEARTQLANLLTYMDGKTG
AEEIIMKAIKDPALLQALASAPKPADSEPNA
 
Nucleotide Sequence: 516 bp     [Download]
>gi|70728250|ref|NC_004129.6|:6914043-6914558 Pseudomonas fluorescens Pf-5 chromosome, complete genome
GTGGCGAAGCAAAGTTCTCAAAAGTTCATCGCGCGCAACCGCGCGCCCCGGGTGCAGATCGAGTACGACG
TCGAACTCTACGGCGCCGAGAAAAAGGTCCAGCTGCCCTTCGTCATGGGCGTGATGGCCGACCTCGCCGG
CAAGCCCGTGGAGCCCCTGGCGGCCGTGGCCGATCGCAAGTTCCTGGAAATCGACGTCGATAACTTCGAC
TCGCGCCTCAAGGCCATGCAGCCTCGGGTGGCCTTCCACGTGCCCAACGAACTGACCGGCGAAGGCAACC
TGAGCCTGGACATCACCTTCGAGAGCATGGACGACTTCAGCCCGGCGGCCGTGGCGCGCAAGGTCGATTC
GTTGAACCAGTTGCTGGAAGCCCGCACCCAGCTGGCCAACCTGCTGACCTACATGGACGGCAAGACCGGC
GCCGAAGAAATCATCATGAAAGCCATCAAGGATCCGGCGTTGCTCCAGGCCCTGGCCAGTGCGCCAAAGC
CTGCTGACTCCGAGCCGAACGCGTAA