SecReT6
Protein ID: 70733371
SecReT6 ID35
T6SS typei3
Gene symboltssC
Locus tagPFL_6088
StrainPseudomonas protegens Pf-5
Repliconchromosome [GenBank: NC_004129] [Browse all T6SS(s) in this replicon]
Location [Strand]6914575..6916068 [+]
Producttype VI secretion protein TssC
NoteTssC
UniProt IDQ4K3N7
KEGG IDpfl:PFL_6088
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.80E-196, Aligned region: 66..492
BMFP [PF04380], Evalue: 0.0007, Aligned region: 18..79
Protein Sequence: 497 a.a.     [Download]
>gi|70733371|ref|YP_263146.1| tssC gene product [Pseudomonas fluorescens Pf-5]
MTELMRDNQAQPGATEQASEFASLLLQEFKPKTERAREAVETAVRTLAEQALAQTDLVSNDAIKSIESII
AAIDAKLTAQVNQVIHHPEFQKLESAWRGLHYLVNNTETDEQLKIRVLNISKPELHKTLKKFKGTAWDQS
PLFKKMYEEEYGQFGGEPYGCLVGDYYFDQSPPDVELLGELSKVCAAMHSPFIAAASPTVMGMGSWQELS
NPRDLTKIFTTPEYAGWRSLRESEDSRYIGLTMPRFLARLPYGAKTDPVEAFAFEENTDGADSSKYTWAN
AAYAMAVNINRSFKHFGWCSRIRGVESGGEVENLPAHTFPTDDGGVDMKCPTEIAISDRREAELAKNGFM
PLLHKKNTDFAAFIGAQSLQKPAEYDDPDATANANLAARLPYLFATCRFAHYLKCIVRDKIGSFKEKDEM
QRWLQDWILNYVDGDPAHSTETTKAQHPLAAAEVVVEEVEGNPGYYNSKFFLRPHYQLEGLTVSLRLVSK
LPSAKGA
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|70728250|ref|NC_004129.6|:6914575-6916068 Pseudomonas fluorescens Pf-5 chromosome, complete genome
ATGACCGAATTGATGCGTGACAATCAGGCGCAACCCGGCGCCACCGAGCAGGCCAGCGAATTCGCATCGC
TGCTGCTGCAGGAATTCAAGCCCAAGACCGAGCGTGCTCGCGAAGCCGTGGAAACCGCGGTGCGGACCCT
GGCCGAACAGGCCCTGGCGCAGACCGACCTGGTGTCCAACGACGCCATCAAGTCGATCGAGTCGATCATC
GCCGCCATCGACGCCAAGCTCACCGCCCAGGTCAACCAGGTGATCCATCACCCGGAATTCCAGAAGCTGG
AAAGCGCCTGGCGCGGCCTGCACTACCTGGTGAACAACACCGAGACCGACGAGCAGCTCAAGATCCGCGT
GCTCAACATCTCCAAGCCGGAGCTGCACAAGACCCTGAAGAAATTCAAGGGCACGGCCTGGGACCAGAGC
CCGCTCTTCAAGAAGATGTACGAAGAGGAATACGGCCAGTTCGGCGGCGAGCCCTACGGCTGCCTGGTGG
GCGACTACTACTTCGACCAGTCGCCACCGGATGTCGAGCTGCTGGGCGAGCTGTCCAAGGTTTGCGCCGC
CATGCACTCGCCGTTCATCGCCGCGGCTTCGCCGACCGTGATGGGCATGGGCTCGTGGCAGGAACTGTCG
AACCCGCGCGACCTGACCAAGATCTTCACCACCCCGGAATACGCCGGCTGGCGCTCGCTGCGTGAATCGG
AAGACTCGCGCTACATCGGCCTGACCATGCCGCGCTTCCTGGCGCGCCTGCCATACGGTGCCAAGACCGA
CCCGGTGGAAGCCTTCGCCTTCGAGGAAAACACCGACGGCGCCGACAGCTCCAAGTACACCTGGGCCAAC
GCCGCCTACGCCATGGCCGTGAACATCAACCGTTCGTTCAAGCATTTCGGCTGGTGCTCGCGGATCCGCG
GCGTGGAGTCCGGTGGCGAGGTGGAAAACCTCCCGGCCCACACCTTCCCCACCGACGACGGTGGCGTGGA
CATGAAGTGCCCGACCGAGATCGCCATCTCCGACCGTCGTGAAGCGGAACTGGCGAAGAACGGCTTCATG
CCACTGCTGCACAAGAAGAACACCGACTTCGCCGCCTTCATCGGCGCCCAGTCGCTGCAGAAGCCGGCCG
AATACGACGACCCGGACGCCACCGCCAACGCCAACCTGGCCGCGCGCCTGCCGTACCTGTTCGCCACTTG
CCGCTTCGCTCACTACTTGAAGTGCATCGTGCGCGACAAGATCGGCTCCTTCAAAGAGAAGGACGAGATG
CAGCGCTGGCTGCAGGACTGGATCCTCAACTACGTCGACGGTGACCCGGCGCACTCCACCGAAACCACCA
AGGCCCAGCACCCACTGGCCGCGGCAGAGGTGGTGGTCGAGGAAGTCGAAGGCAACCCCGGCTACTACAA
CTCGAAGTTCTTCCTGCGCCCGCACTACCAGCTCGAAGGGCTGACCGTGTCGTTGCGCCTGGTATCCAAA
CTGCCGTCCGCCAAGGGCGCCTAA