SecReT6
Protein ID: 70733374
SecReT6 ID35
T6SS typei3
Gene symboltssF
Locus tagPFL_6091
StrainPseudomonas protegens Pf-5
Repliconchromosome [GenBank: NC_004129] [Browse all T6SS(s) in this replicon]
Location [Strand]6917348..6919207 [+]
Producttype VI secretion protein TssF
NoteTssF
UniProt IDQ4K3N4
KEGG IDpfl:PFL_6091
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.80E-217, Aligned region: 5..618
Protein Sequence: 619 a.a.     [Download]
>gi|70733374|ref|YP_263149.1| tssF gene product [Pseudomonas fluorescens Pf-5]
MNPRLLELYNQELHHVRESAAEFAKEFPKIASRLTLSGMDCADPYVERLLEGFAYLTARVQLKLDAEYPT
FTHNLLEIAYPHYLAPTPSMTVVQLQADPDEGSLSSGFTLERDTSLRAALGRDTQTCCEYRTAHSVTLWP
LQVAQAEYFGNPSAVLGRLAASEPRAKAGLRLTLRTGAELPFNSLALDELPLYLNGNDEQPFRLYEQLLG
NVCAVFARAPGGDWVERLPPDALRSRGFDDRDAALPVVPQAFQGYRLLQEYFALPNRFLFVEFAQLGRAV
QRCAGQELELIVLFERFDQSLEGSVGTAQFVPFCTPAINLFPKRLDRIHLSDRVNEHHVIADRTRPMDFE
VHSLTAISGHGTGPEQPFLPFYAVRDPSRYGRDQSYYIVRREPRVLSSDQRRNGPRSTYIGSESFVSLVD
SQQAPYRHDLRQLGVSALCTNRDLPLFMNTGNGKTDFTLADSAPVQAIRCLAGPSRPRPSHAHDGKAWRL
ISQLSLNYLSLSEQGQGAAALRELLRLYGDSNDAALQLQIEGLREVSSKAVTRRLPMPGPIVFGRGLEIT
LEFDENAFRGTGVFLLGAVFERFLARYVSINSFTETVIRTTERGEIMRWKAKPGRRPTL
 
Nucleotide Sequence: 1860 bp     [Download]
>gi|70728250|ref|NC_004129.6|:6917348-6919207 Pseudomonas fluorescens Pf-5 chromosome, complete genome
ATGAACCCGCGCCTGCTGGAGCTGTACAACCAGGAACTGCACCACGTGCGCGAAAGCGCCGCGGAGTTCG
CCAAGGAATTCCCGAAGATCGCCAGCCGCCTGACCCTGTCGGGCATGGACTGCGCCGACCCCTATGTCGA
GCGCCTGCTGGAGGGCTTCGCCTACCTGACTGCCCGGGTGCAGCTCAAGCTCGACGCCGAGTACCCGACC
TTCACCCACAACCTGCTGGAGATCGCCTACCCGCACTACCTGGCACCGACCCCATCGATGACCGTGGTGC
AGTTGCAGGCCGATCCCGACGAAGGTTCCCTGAGCAGCGGCTTCACCCTGGAGCGCGACACCAGCCTGCG
CGCCGCCCTGGGCCGCGATACCCAGACCTGCTGCGAATACCGCACCGCGCACTCGGTGACCCTGTGGCCA
CTGCAAGTGGCCCAGGCCGAATACTTCGGCAACCCGTCGGCAGTGCTCGGGCGCCTGGCCGCCAGCGAAC
CCAGGGCCAAGGCCGGGCTGCGCCTGACCCTGCGCACCGGCGCCGAACTGCCGTTCAACAGCCTGGCCCT
GGACGAGTTGCCGCTGTACCTGAACGGCAATGACGAACAGCCGTTCCGCCTCTACGAACAACTGCTGGGC
AACGTCTGCGCGGTGTTCGCCCGGGCCCCGGGCGGCGACTGGGTCGAGCGCCTGCCCCCGGACGCCCTGC
GCTCGCGCGGTTTCGACGACCGCGACGCGGCGCTGCCGGTGGTGCCCCAGGCCTTCCAGGGCTACCGCCT
GCTGCAGGAATACTTCGCCCTGCCCAACCGCTTCCTGTTCGTCGAATTCGCCCAGCTGGGGCGCGCGGTC
CAGCGCTGCGCCGGCCAGGAGCTGGAGCTGATCGTGCTCTTCGAGCGCTTCGACCAGAGCCTGGAAGGCA
GCGTCGGCACCGCTCAGTTCGTGCCCTTCTGCACCCCGGCGATCAACCTGTTTCCCAAGCGCCTGGACCG
TATCCACCTGTCCGACCGGGTCAACGAGCACCATGTGATCGCCGACCGCACCCGCCCGATGGATTTCGAG
GTCCACTCGCTGACCGCTATCAGCGGCCACGGCACCGGCCCGGAACAGCCGTTCCTGCCGTTCTACGCCG
TGCGCGATCCATCCCGCTACGGCCGCGACCAGTCCTACTACATCGTCCGGCGCGAGCCGCGGGTGCTGTC
CAGCGACCAGCGTCGCAACGGCCCGCGCTCCACCTACATCGGCAGCGAATCCTTCGTCAGCCTGGTGGAC
AGCCAGCAGGCGCCCTATCGCCACGACCTGCGCCAGCTCGGGGTCAGCGCGCTGTGCACCAACCGCGACC
TGCCACTGTTCATGAACACCGGCAACGGCAAGACCGACTTCACCCTGGCCGACAGCGCCCCGGTACAGGC
CATCCGCTGCCTGGCGGGCCCGAGCCGGCCGCGCCCCAGCCATGCCCACGACGGCAAGGCCTGGCGCCTG
ATCAGCCAGCTGTCGCTGAACTACCTGTCCCTGAGCGAACAGGGCCAGGGCGCGGCGGCCCTGCGCGAAC
TGCTGCGGTTGTACGGCGACAGCAACGACGCGGCCCTGCAGTTGCAGATCGAGGGCCTGCGGGAAGTCAG
CAGCAAGGCGGTGACCCGGCGCCTGCCGATGCCCGGGCCGATCGTCTTCGGCCGGGGCCTGGAGATCACC
CTGGAGTTCGATGAAAACGCGTTCCGCGGCACCGGGGTGTTTCTGCTCGGCGCGGTATTCGAGCGCTTCC
TGGCACGTTATGTGTCGATCAACAGTTTTACCGAGACGGTGATCCGTACCACCGAACGCGGCGAGATCAT
GCGATGGAAAGCCAAGCCCGGACGTCGTCCGACTCTTTGA