SecReT6
Protein ID: 70733375
SecReT6 ID35
T6SS typei3
Gene symboltssG
Locus tagPFL_6092
StrainPseudomonas protegens Pf-5
Repliconchromosome [GenBank: NC_004129] [Browse all T6SS(s) in this replicon]
Location [Strand]6919171..6920223 [+]
Producttype VI secretion protein TssG
NoteTssG
UniProt IDQ4K3N3
KEGG IDpfl:PFL_6092
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.80E-111, Aligned region: 20..320
Protein Sequence: 350 a.a.     [Download]
>gi|70733375|ref|YP_263150.1| tssG gene product [Pseudomonas fluorescens Pf-5]
MESQARTSSDSLNTLTAMHAEPWEYDFFQALRRIECLSPQLPRFGHSVRLADDPLRLGQQADCSFAPATL
ASVTPGSDGAATRLEQFFFGLGGPNGPLPLHITEYVRERQRNNADSTSKRFLDVFHHRLLSLFYRAWAEA
RPTVSHDRPDDDYWSARLAALSGRGMPSLLKQGLIADTAKLHYSGHLAAQTRYPDGLRAIISEYFGLPVQ
IEEYVGQWLELPERSRVGVQSHQLGVDFCLGSHVWDRQHKFRIRLGPMKLDDYLGMLPDGQQFQELVAWA
AEYLGFELDWDLNLVLLKDEVPKLQLNGRQRLGFNTWLGQPGSDAKDLILARHYADLATTSRTPRSTEHG
 
Nucleotide Sequence: 1053 bp     [Download]
>gi|70728250|ref|NC_004129.6|:6919171-6920223 Pseudomonas fluorescens Pf-5 chromosome, complete genome
ATGGAAAGCCAAGCCCGGACGTCGTCCGACTCTTTGAATACGCTGACGGCGATGCACGCCGAGCCCTGGG
AGTACGACTTCTTCCAGGCCCTGCGGCGTATCGAATGCCTGTCGCCGCAACTGCCGCGCTTCGGTCACTC
CGTGCGCCTGGCGGACGATCCGCTGCGCCTGGGACAGCAGGCCGACTGCAGCTTCGCCCCGGCCACCCTG
GCCTCGGTCACCCCCGGCAGCGACGGCGCCGCGACCCGCCTGGAGCAGTTCTTCTTCGGCCTCGGCGGGC
CCAACGGGCCGCTGCCGCTGCACATCACCGAATACGTGCGCGAGCGCCAGCGCAACAACGCCGACAGCAC
CAGCAAGCGCTTTCTCGATGTGTTCCACCACCGCCTGCTGAGCCTGTTCTATCGGGCCTGGGCCGAAGCC
CGGCCGACGGTGAGCCACGATCGCCCGGACGACGACTACTGGTCGGCGCGGCTGGCGGCGCTGTCGGGCC
GGGGCATGCCCAGCCTGCTCAAGCAGGGTCTGATAGCCGACACCGCCAAGCTGCATTACAGCGGCCACCT
GGCGGCCCAGACCCGCTACCCGGACGGCTTGCGGGCGATCATCAGCGAGTATTTCGGCCTGCCGGTGCAG
ATCGAGGAATATGTCGGCCAGTGGCTGGAGTTGCCCGAACGCAGCCGGGTCGGGGTGCAATCCCATCAGC
TGGGGGTGGATTTCTGCCTGGGCAGCCACGTCTGGGACCGCCAGCACAAGTTCCGCATCCGCCTCGGCCC
GATGAAACTGGACGATTACCTGGGGATGCTGCCCGACGGCCAGCAATTCCAGGAACTGGTGGCCTGGGCC
GCCGAATACCTGGGCTTCGAGCTGGACTGGGACCTGAACCTGGTCCTGCTCAAGGACGAAGTGCCCAAGC
TGCAACTCAACGGCCGCCAGCGCCTGGGTTTCAACACCTGGCTCGGCCAACCCGGCAGCGATGCCAAGGA
TCTAATACTGGCCCGGCACTACGCCGACCTGGCCACTACCTCACGTACACCAAGGAGCACAGAGCATGGG
TGA