SecReT6
Protein ID: 70733376
SecReT6 ID35
T6SS typei3
Gene symbolclpV
Locus tagPFL_6093
StrainPseudomonas protegens Pf-5
Repliconchromosome [GenBank: NC_004129] [Browse all T6SS(s) in this replicon]
Location [Strand]6920216..6922891 [+]
Producttype VI secretion ATPase ClpV
NoteTssH
UniProt IDQ4K3N2
KEGG IDpfl:PFL_6093
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.20E-39, Aligned region: 620..786
AAA [PF00004], Evalue: 1.10E-18, Aligned region: 234..368
AAA [PF00004], Evalue: 1.10E-18, Aligned region: 626..710
ClpB_D2-small [PF10431], Evalue: 7.20E-16, Aligned region: 48..61
ClpB_D2-small [PF10431], Evalue: 7.20E-16, Aligned region: 793..867
AAA_5 [PF07728], Evalue: 1.20E-12, Aligned region: 234..253
AAA_5 [PF07728], Evalue: 1.20E-12, Aligned region: 351..364
AAA_5 [PF07728], Evalue: 1.20E-12, Aligned region: 625..754
AAA_16 [PF13191], Evalue: 1.10E-11, Aligned region: 37..78
AAA_16 [PF13191], Evalue: 1.10E-11, Aligned region: 211..251
AAA_16 [PF13191], Evalue: 1.10E-11, Aligned region: 278..313
AAA_16 [PF13191], Evalue: 1.10E-11, Aligned region: 488..488
AAA_16 [PF13191], Evalue: 1.10E-11, Aligned region: 595..670
AAA_16 [PF13191], Evalue: 1.10E-11, Aligned region: 784..840
Sigma54_activat [PF00158], Evalue: 6.50E-07, Aligned region: 213..247
Sigma54_activat [PF00158], Evalue: 6.50E-07, Aligned region: 624..743
AAA_22 [PF13401], Evalue: 9.90E-07, Aligned region: 64..98
AAA_22 [PF13401], Evalue: 9.90E-07, Aligned region: 233..315
AAA_22 [PF13401], Evalue: 9.90E-07, Aligned region: 356..395
AAA_22 [PF13401], Evalue: 9.90E-07, Aligned region: 623..646
AAA_22 [PF13401], Evalue: 9.90E-07, Aligned region: 687..708
AAA_25 [PF13481], Evalue: 5.80E-06, Aligned region: 229..311
AAA_25 [PF13481], Evalue: 5.80E-06, Aligned region: 623..650
Zeta_toxin [PF06414], Evalue: 4.30E-05, Aligned region: 234..250
Zeta_toxin [PF06414], Evalue: 4.30E-05, Aligned region: 620..665
Arch_ATPase [PF01637], Evalue: 0.00015, Aligned region: 212..250
Arch_ATPase [PF01637], Evalue: 0.00015, Aligned region: 285..318
Arch_ATPase [PF01637], Evalue: 0.00015, Aligned region: 625..646
Arch_ATPase [PF01637], Evalue: 0.00015, Aligned region: 696..707
AAA_18 [PF13238], Evalue: 0.00018, Aligned region: 234..251
AAA_18 [PF13238], Evalue: 0.00018, Aligned region: 627..650
AAA_18 [PF13238], Evalue: 0.00018, Aligned region: 813..856
AAA_19 [PF13245], Evalue: 0.00032, Aligned region: 17..46
AAA_19 [PF13245], Evalue: 0.00032, Aligned region: 234..255
AAA_19 [PF13245], Evalue: 0.00032, Aligned region: 623..647
NACHT [PF05729], Evalue: 0.00037, Aligned region: 234..334
NACHT [PF05729], Evalue: 0.00037, Aligned region: 626..652
IstB_IS21 [PF01695], Evalue: 0.00039, Aligned region: 217..255
IstB_IS21 [PF01695], Evalue: 0.00039, Aligned region: 625..653
AAA_17 [PF13207], Evalue: 0.0011, Aligned region: 234..251
AAA_17 [PF13207], Evalue: 0.0011, Aligned region: 625..660
AAA_17 [PF13207], Evalue: 0.0011, Aligned region: 813..835
AAA_29 [PF13555], Evalue: 0.0018, Aligned region: 226..250
AAA_29 [PF13555], Evalue: 0.0018, Aligned region: 623..650
Torsin [PF06309], Evalue: 0.0021, Aligned region: 583..649
Protein Sequence: 891 a.a.     [Download]
>gi|70733376|ref|YP_263151.1| clpV gene product [Pseudomonas fluorescens Pf-5]
MGEISRAALFGKLNSVAYKAIEAATVFCKLRGNPYVELAHWFHQLLQLTDSDLHRIIRQFNLEPARLAKD
LTEALDRLPRGSTSITDLSSHVEEAVERGWVYGSLMFGESQVRTGYLVIGILKTPSLRHALLGLSREFDK
IKVETLCERFDEYIGDSPENALSASDGFSAGAVPGEASGAMAPSALGKQEALKRFTVDLTEQARSGKLDP
IVGRDEEIRQLVDILMRRRQNNPILTGEAGVGKTAVVEGFALRIVAGDVPPALKDVELRSLDVGLLQAGA
SMKGEFEQRLRQVIEDVQASPKPIILFIDEAHTLVGAGGAAGTGDAANLLKPALARGTLRTVAATTWAEY
KKHIEKDPALTRRFQVVQVAEPSEDKALLMMRGVASTMEQHHQVQILDEALEASVKLSHRYIPARQLPDK
SVSLLDTACARVAISLHAVPAEVDDSRRRIEALETELQIIAREQAIGVAIGNRQVNSENLLTAERERLAE
LESRWAQEKTLVDELLATRAQLRENVGLVDSDVGDDSHGLREKLVDLQQRLSTLQGETPLILPTVDYQAV
ASVVADWTGIPVGRMARNELETVLNLDQHLKKRIIGQDHALQMIAKRIQTSRAGLDNPNKPIGVFMLAGT
SGVGKTETALALAEAMYGGEQNVITINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEAVRRKPYSVVLL
DEVEKAHPDVHEIFFQVFDKGVMEDGEGRMIDFKNTLILLTTNAGTELIANVCKNPQAVPEPEEIAKALR
QPLLEIFPPALLGRLVTIPYYPLSDEMLKAITRLQLGRIKKRVESTHKVDFDFDDEVIDLIVSRCTETES
GGRMIDAILTNSLLPDMSREFLNRMLEGRALAGVRISQRDNELHYDFSEPA
 
Nucleotide Sequence: 2676 bp     [Download]
>gi|70728250|ref|NC_004129.6|:6920216-6922891 Pseudomonas fluorescens Pf-5 chromosome, complete genome
ATGGGTGAAATCAGTCGCGCGGCGCTGTTCGGCAAACTCAACAGCGTTGCCTACAAAGCCATCGAAGCCG
CCACGGTCTTCTGCAAATTGCGGGGCAACCCCTATGTGGAACTGGCCCACTGGTTTCACCAGTTGCTGCA
ACTTACGGACTCGGACCTGCACCGCATCATCCGCCAGTTCAACCTGGAGCCGGCGCGCCTGGCCAAGGAC
CTGACCGAGGCCCTGGACCGCCTGCCCCGGGGCTCGACCTCGATCACCGACCTGTCGTCCCACGTCGAGG
AGGCGGTGGAGCGCGGTTGGGTCTACGGCAGCCTGATGTTCGGCGAAAGCCAGGTGCGCACCGGCTACCT
GGTGATCGGCATCCTCAAGACCCCGAGCCTGCGCCATGCGTTGCTGGGGCTGTCCCGCGAGTTCGACAAG
ATCAAGGTCGAGACCCTGTGCGAGCGCTTTGACGAATACATCGGCGACTCGCCGGAAAACGCCCTGAGCG
CCAGCGACGGCTTCAGTGCCGGTGCGGTGCCCGGCGAAGCCAGCGGCGCCATGGCCCCCAGCGCCCTGGG
CAAGCAGGAAGCCCTCAAGCGCTTCACCGTCGACCTCACCGAACAGGCCCGCAGCGGCAAGCTCGACCCC
ATCGTCGGCCGTGACGAAGAGATCCGCCAACTGGTGGACATCCTCATGCGCCGCCGGCAGAACAACCCGA
TCCTCACCGGTGAAGCCGGGGTGGGCAAGACCGCGGTGGTGGAAGGTTTCGCCCTGCGCATCGTCGCCGG
CGACGTGCCGCCGGCGCTCAAGGACGTTGAACTGCGCAGCCTCGACGTCGGCCTGCTGCAGGCCGGCGCC
AGCATGAAGGGCGAGTTCGAACAGCGCCTGCGCCAGGTCATCGAGGACGTCCAGGCCTCGCCCAAGCCGA
TCATCCTGTTCATCGACGAAGCCCACACCCTGGTGGGCGCCGGTGGCGCCGCCGGCACCGGCGACGCGGC
CAACCTGCTCAAGCCGGCTCTGGCCCGTGGTACCCTGCGCACCGTGGCCGCCACCACCTGGGCCGAGTAC
AAGAAGCACATCGAGAAAGACCCGGCCCTGACCCGGCGCTTCCAGGTGGTGCAAGTAGCCGAACCTTCGG
AAGACAAGGCGCTGCTGATGATGCGCGGCGTGGCCTCGACCATGGAACAGCACCATCAGGTGCAGATCCT
CGACGAAGCCCTGGAGGCCTCGGTCAAACTGTCCCATCGCTACATTCCCGCGCGCCAGTTGCCGGACAAA
TCCGTCAGCCTGCTGGATACCGCTTGCGCCCGCGTCGCCATCAGCCTGCACGCCGTGCCGGCCGAGGTGG
ACGATAGCCGCCGGCGCATCGAGGCCCTGGAAACCGAGCTGCAGATCATCGCCCGGGAACAGGCGATCGG
CGTTGCCATTGGCAACCGCCAGGTCAACAGCGAGAACCTCCTGACTGCCGAGCGCGAGCGCCTGGCCGAG
CTGGAAAGTCGCTGGGCACAAGAGAAGACCCTGGTGGACGAACTGCTGGCAACCCGCGCCCAATTGCGGG
AAAACGTCGGCTTGGTGGACAGCGACGTCGGCGACGACAGCCACGGCCTGCGGGAAAAACTGGTGGACCT
GCAACAGCGCCTCAGCACTCTGCAAGGCGAGACCCCGCTGATCCTGCCGACCGTGGACTACCAGGCCGTG
GCCTCGGTGGTCGCCGACTGGACCGGCATTCCAGTGGGGCGCATGGCCCGCAACGAGCTGGAAACCGTGC
TCAACCTGGACCAGCACCTGAAGAAACGCATCATCGGCCAGGACCACGCCCTGCAGATGATCGCCAAGCG
CATCCAGACCTCCCGCGCCGGCCTCGACAACCCCAACAAGCCGATCGGCGTGTTCATGCTGGCCGGCACT
TCCGGGGTGGGCAAGACCGAAACCGCCCTGGCCCTGGCCGAAGCCATGTATGGCGGAGAGCAGAACGTCA
TCACCATCAACATGAGCGAGTTCCAGGAAGCCCACACCGTGTCCACCCTCAAGGGCGCCCCGCCGGGCTA
TGTCGGCTACGGCGAAGGTGGCGTGCTCACCGAAGCGGTACGGCGCAAGCCCTACAGCGTGGTGCTGCTG
GACGAAGTGGAAAAGGCCCACCCGGACGTGCACGAGATCTTCTTCCAGGTATTCGACAAGGGCGTCATGG
AAGACGGCGAAGGCCGCATGATCGACTTCAAGAACACCCTGATCCTGCTTACCACCAACGCCGGCACCGA
GCTGATCGCCAACGTCTGCAAGAACCCGCAGGCGGTGCCCGAGCCGGAGGAAATCGCCAAGGCCCTGCGC
CAGCCACTGCTGGAGATCTTCCCGCCGGCACTGCTGGGGCGCCTGGTGACCATTCCCTACTACCCGCTGA
GCGACGAGATGCTCAAGGCCATCACCCGCCTGCAACTGGGGCGGATCAAGAAGCGCGTGGAAAGCACCCA
CAAGGTGGATTTCGATTTCGACGACGAGGTCATCGACCTGATCGTCTCGCGCTGCACCGAGACCGAAAGC
GGCGGGCGGATGATCGACGCCATCCTGACCAACAGCCTGCTGCCGGACATGAGCCGCGAGTTCCTCAACC
GCATGCTCGAAGGCCGCGCCCTGGCCGGGGTGCGCATCAGCCAGCGCGACAACGAACTGCACTACGACTT
CAGCGAGCCGGCCTGA