SecReT6
Protein ID: 70733377
SecReT6 ID35
T6SS typei3
Gene symbolvgrG
Locus tagPFL_6094
StrainPseudomonas protegens Pf-5
Repliconchromosome [GenBank: NC_004129] [Browse all T6SS(s) in this replicon]
Location [Strand]6923022..6924959 [+]
Producttype VI secretion protein VgrG
NoteTssI
UniProt IDQ4K3N1
KEGG IDpfl:PFL_6094
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 8.00E-87, Aligned region: 30..329
Phage_base_V [PF04717], Evalue: 1.40E-25, Aligned region: 369..462
Protein Sequence: 645 a.a.     [Download]
>gi|70733377|ref|YP_263152.1| vgrG gene product [Pseudomonas fluorescens Pf-5]
MLFQQSTRLAQVNCPLGPDVLLLKSLGGGEELGRLFDYQLQLASSDANIDLNQLLGKPMGLSVQLDGGGQ
RYFHGIVARCSQNIDTGQFASYEVTLRPWLWLLSRTSDCRIFQNLSIPQIIKQVFRDLGFSDFEDALSRP
YREWEYCVQYRETSFDFVSRLMEQEGIYYFFRHEKDRHVVVLADAYGAHSSVPGYASVPYYPRDEQQRER
DHMFDWHLAQEVQPGSLELNDYDFQRPSARIDVRSAMPRPHSAGDYPLYDYPGTYVQSSDGEHYAQTRIE
ALQSLHERIELSGNARGLGVGNLFSLTGFSRQDQNREYLIVSIRYYLVQESLESGAGGGSAQFESHLTCI
DAQQSFRPLATTHKPMVQGPQTARVVGPAGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWIRVSQAWAGK
NWGSMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYDLPANATQSGMKSRSSKGGSPANFNEIRM
EDKKGAEQLYIHAERNQDIVVEVNESHSVGNNRNKSIGHDEYVTIGNKRTRIVQHVDELRVGEKKLDSVG
QSYVIEVGERLRLVCGASILELNASGQINLCGVNISVHASADAQINTGGVLHLNNGGGPGTTTEGQGVQG
AISAKAKAPFSAPKG
 
Nucleotide Sequence: 1938 bp     [Download]
>gi|70728250|ref|NC_004129.6|:6923022-6924959 Pseudomonas fluorescens Pf-5 chromosome, complete genome
ATGTTATTTCAGCAATCCACACGACTGGCACAGGTCAACTGCCCCCTGGGCCCGGACGTCCTGCTGCTCA
AGAGCCTGGGCGGCGGCGAGGAGCTGGGGCGGCTGTTCGACTACCAGCTGCAACTGGCCTCCAGTGACGC
CAACATCGACCTCAACCAGTTGCTGGGCAAGCCCATGGGCCTCAGCGTACAGCTGGACGGCGGCGGCCAG
CGGTACTTCCACGGCATCGTCGCGCGCTGCAGCCAGAACATCGACACCGGCCAGTTCGCCAGCTACGAGG
TGACGCTGCGCCCCTGGCTGTGGCTGCTGAGCCGCACCTCCGACTGCCGGATCTTCCAGAACCTGAGCAT
CCCGCAGATCATCAAGCAGGTGTTCCGCGACCTGGGCTTTTCCGATTTCGAAGACGCCCTGAGCCGCCCC
TACCGGGAGTGGGAGTACTGCGTGCAGTACCGCGAGACCAGCTTCGATTTCGTCAGCCGGCTGATGGAAC
AGGAAGGTATCTACTACTTCTTCCGCCACGAGAAGGACCGCCACGTGGTGGTGCTGGCCGACGCCTATGG
CGCTCACAGCAGCGTGCCCGGCTACGCCTCGGTGCCCTACTACCCGCGAGACGAGCAGCAGCGCGAGCGC
GACCACATGTTCGACTGGCACCTGGCCCAGGAGGTGCAGCCCGGCTCGCTGGAGCTCAACGACTATGATT
TCCAGCGCCCCAGCGCCCGGATCGACGTGCGCTCGGCCATGCCGCGGCCCCACAGCGCCGGCGACTACCC
GCTCTACGACTACCCCGGCACCTACGTGCAGAGCAGCGACGGCGAGCACTATGCCCAGACCCGCATCGAG
GCCCTGCAAAGCCTGCATGAGCGCATCGAGCTCAGCGGCAACGCCCGGGGGTTGGGGGTGGGCAACCTGT
TCAGCCTCACCGGCTTCAGCCGCCAGGACCAGAACCGCGAATACCTGATCGTCAGCATCCGCTACTACCT
GGTCCAGGAAAGCCTGGAGAGCGGCGCTGGCGGCGGCTCGGCGCAGTTCGAGAGCCACCTGACCTGCATC
GACGCCCAGCAGAGCTTCCGCCCCCTGGCCACCACCCACAAGCCCATGGTCCAGGGCCCGCAGACCGCGC
GAGTGGTGGGCCCGGCCGGGGAAGAGATCTGGACCGACCAGTACGGCCGGGTCAAGGTGCACTTCCACTG
GGACCGCCACGACCAGTCCAACGAAAACAGCTCGTGCTGGATTCGCGTGTCCCAGGCCTGGGCCGGGAAG
AACTGGGGCTCGATGCAGATCCCGCGCATCGGCCAGGAAGTCATCGTCAGCTTCCTGGAAGGCGATCCCG
ATCGCCCGATCATCACCGGCCGGGTCTACAACGCCGAACAGACCGTGCCCTACGACCTGCCCGCCAACGC
CACCCAGAGCGGCATGAAGAGCCGTTCGAGCAAGGGCGGCAGCCCGGCCAACTTCAATGAAATCCGCATG
GAAGACAAAAAGGGCGCGGAGCAGCTGTACATCCACGCCGAGCGCAACCAGGACATCGTGGTCGAGGTCA
ACGAAAGCCATTCGGTGGGCAACAACCGCAACAAGAGCATCGGCCACGACGAGTACGTGACCATCGGCAA
CAAGCGCACGCGCATCGTCCAGCACGTGGATGAGCTGCGGGTCGGCGAGAAGAAGCTCGACAGCGTCGGC
CAGAGCTATGTGATCGAGGTCGGCGAGCGCCTGCGCCTGGTATGCGGGGCCAGCATCCTAGAGCTCAACG
CCAGCGGCCAGATCAACCTGTGCGGGGTCAACATCAGCGTGCATGCCTCGGCCGATGCCCAGATCAATAC
CGGTGGCGTGCTGCACCTGAACAACGGCGGCGGCCCGGGCACCACCACCGAGGGCCAGGGTGTGCAGGGC
GCCATCAGCGCCAAGGCCAAAGCCCCCTTTTCCGCCCCCAAAGGCTAA