SecReT6
Protein ID: 71733359
SecReT6 ID55
T6SS typei4b
Gene symbol-
Locus tagPSPPH_0128
StrainPseudomonas syringae pv. phaseolicola 1448A
Repliconchromosome [GenBank: NC_005773] [Browse all T6SS(s) in this replicon]
Location [Strand]150125..150880 [-]
Productlipoprotein
NoteTssJ
UniProt IDQ48Q78
KEGG IDpsp:PSPPH_0128
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.10E-32, Aligned region: 25..182
Protein Sequence: 251 a.a.     [Download]
>gi|71733359|ref|YP_272438.1| unnamed protein product [Pseudomonas syringae pv. phaseolicola 1448A]
MNKRLQGNCSSKPALARCLAVLAMMLALSACGVTDRVAKRMDDTWAGDMMFGDNEKVILTTDGGNQLNPD
EYGKPLSVVVRVYQLSSLERFESINADTLWDDPQKALGNTLVESRELILLPGIGETDQWPLNPNASYVGI
AAFFRTDVDSRWKVAFDANTLRKDGIWFSSDGVRVLVDNNYILAVRGVDVLNRLKTEEQFTKSNSMPEQP
AGKGITERVQDAAVQQVQDSAGSAAKKAADSQFNSLLEGAK
 
Nucleotide Sequence: 756 bp     [Download]
>gi|71733195|ref|NC_005773.3|:c150880-150125 Pseudomonas syringae pv. phaseolicola 1448A chromosome, complete genome
ATGAATAAAAGACTTCAAGGCAATTGTTCCTCGAAGCCAGCCTTGGCAAGGTGCCTGGCTGTTCTGGCAA
TGATGCTGGCTCTGTCCGCCTGTGGCGTGACGGACCGTGTCGCCAAGCGCATGGATGACACCTGGGCTGG
CGACATGATGTTTGGTGACAACGAAAAGGTCATCCTGACGACTGACGGCGGTAATCAGCTCAACCCTGAC
GAGTACGGCAAACCGCTCTCGGTGGTGGTGCGCGTTTATCAACTGTCCTCTCTGGAGCGCTTCGAGTCAA
TCAACGCCGACACCCTCTGGGATGATCCGCAAAAGGCTCTGGGCAACACACTGGTCGAAAGCAGAGAGCT
GATTCTGTTGCCTGGCATAGGCGAGACCGATCAATGGCCGCTGAACCCGAATGCCTCGTATGTGGGCATC
GCGGCGTTCTTCCGCACCGACGTCGACAGCCGCTGGAAGGTCGCGTTCGACGCCAACACGCTGCGCAAGG
ACGGTATCTGGTTCTCGTCCGACGGTGTGCGCGTGCTGGTGGACAACAACTACATCCTCGCCGTTCGTGG
CGTGGATGTGCTGAACAGGCTCAAGACTGAAGAGCAGTTCACTAAATCCAATTCGATGCCCGAACAACCC
GCCGGCAAAGGTATTACCGAGCGTGTGCAGGACGCCGCTGTCCAGCAGGTTCAGGACTCGGCCGGCAGTG
CTGCGAAAAAGGCAGCGGACTCACAATTCAATTCTCTGTTGGAAGGCGCCAAATGA