SecReT6
Protein ID: 71733734
SecReT6 ID55
T6SS typei4b
Gene symbol-
Locus tagPSPPH_0121
StrainPseudomonas syringae pv. phaseolicola 1448A
Repliconchromosome [GenBank: NC_005773] [Browse all T6SS(s) in this replicon]
Location [Strand]138816..139919 [-]
ProductImpA-like N-terminal family protein
NoteTssA
UniProt IDQ48Q85
KEGG IDpsp:PSPPH_0121
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.70E-19, Aligned region: 60..120
Protein Sequence: 367 a.a.     [Download]
>gi|71733734|ref|YP_272431.1| unnamed protein product [Pseudomonas syringae pv. phaseolicola 1448A]
MTMSEFLNDLSLADLTAPINGGSGEDLSFSTLFDQVKEARRADPDYLTQGDWQTDLKSSDWDQTITLAAQ
GLAEQSKDLMLVAWLSEALAHKYHFVGITFGLTVAERILQNFWDDLYPSLEDGVEERAARLAWLKTTLTE
VVGGLPITQGQNFGLLRYDESRHVENLALQNPKAMQAAVDEGKINAEIFQRSVVLTDSDHLRLKASEIAA
SLYACQQLQATADTLFGSDAPSLVTLSDILQRAGQLTEKLLKDRGIELSPAPAAAAQTAPEIAIDQPAGA
AMTQPTQDSASAPLRTTPATRDEAFTMLAGIAQFFKNTEPQSPVPYLIERAIKWGNMPLEGWLNDVIKDS
NVVDSIRDVLGTKEPKQ
 
Nucleotide Sequence: 1104 bp     [Download]
>gi|71733195|ref|NC_005773.3|:c139919-138816 Pseudomonas syringae pv. phaseolicola 1448A chromosome, complete genome
TTGACTATGTCTGAATTTCTCAACGACCTTTCGCTTGCCGATCTGACGGCGCCCATCAACGGGGGCAGCG
GCGAAGACCTGAGCTTTTCCACCCTGTTCGATCAGGTCAAGGAAGCTCGTCGAGCAGACCCCGATTACCT
CACCCAAGGTGACTGGCAAACCGATCTGAAGTCCTCGGACTGGGATCAGACCATCACGTTGGCCGCACAG
GGCCTTGCTGAACAAAGCAAGGACCTGATGCTCGTCGCCTGGCTCAGTGAAGCCCTGGCGCACAAATACC
ACTTTGTCGGCATTACCTTCGGCCTGACCGTGGCCGAGCGGATCCTGCAAAATTTCTGGGACGATCTGTA
CCCGTCGCTGGAAGACGGCGTAGAAGAACGCGCCGCCCGCCTGGCCTGGCTGAAAACCACGCTGACCGAA
GTCGTCGGCGGGCTGCCGATCACCCAGGGGCAGAACTTTGGCCTGTTGCGCTACGACGAGTCGCGCCACG
TGGAAAACCTCGCCCTGCAAAACCCCAAGGCCATGCAGGCTGCTGTTGACGAAGGCAAGATCAACGCCGA
AATCTTCCAGCGCTCCGTGGTACTGACCGACTCGGACCACCTGCGCCTCAAGGCCAGCGAAATCGCTGCC
AGCCTGTACGCCTGCCAGCAGCTCCAGGCCACTGCCGATACCCTGTTCGGCAGCGACGCGCCCAGCCTCG
TCACCCTGAGCGACATCCTGCAACGTGCCGGGCAACTGACCGAAAAGCTGCTCAAGGACCGAGGAATAGA
ACTGAGCCCTGCCCCCGCAGCCGCCGCTCAGACCGCACCCGAAATCGCCATCGACCAACCCGCAGGTGCC
GCGATGACCCAGCCCACCCAGGACAGCGCATCCGCACCACTGCGCACCACCCCGGCCACTCGCGACGAAG
CCTTCACCATGCTCGCCGGCATCGCACAGTTCTTCAAAAACACCGAGCCGCAAAGCCCCGTCCCGTACCT
CATTGAGCGCGCCATCAAGTGGGGCAACATGCCGCTGGAAGGCTGGCTGAACGACGTCATCAAGGACAGC
AACGTCGTGGACAGCATTCGCGATGTGCTGGGTACGAAAGAGCCTAAGCAGTAA