SecReT6
Protein ID: 71733907
SecReT6 ID55
T6SS typei4b
Gene symbol-
Locus tagPSPPH_0126
StrainPseudomonas syringae pv. phaseolicola 1448A
Repliconchromosome [GenBank: NC_005773] [Browse all T6SS(s) in this replicon]
Location [Strand]148075..148788 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ48Q80
KEGG IDpsp:PSPPH_0126
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 8.70E-55, Aligned region: 18..220
Protein Sequence: 237 a.a.     [Download]
>gi|71733907|ref|YP_272436.1| unnamed protein product [Pseudomonas syringae pv. phaseolicola 1448A]
MTEAVMQGAAAAATEKPTLKDLVRDFITMALIVRRGRQAISVTAFEASVDTFFANLERQARSANYSVEQV
KDAQYALCAFLDESVLRSGDNDMRRHFEMEPLQFRYFGVHLAGEGFFEKIELLRADVKKNLDVLEVYHLC
LALGFEGKFGLGQKDQLRYLANTLGQDIARYRKTPKALSPDWALPDQVSQMLRHEVPVWLYLVLIALVCL
GVYLTLDWLLGKDVAALAEQISQLFNA
 
Nucleotide Sequence: 714 bp     [Download]
>gi|71733195|ref|NC_005773.3|:c148788-148075 Pseudomonas syringae pv. phaseolicola 1448A chromosome, complete genome
ATGACTGAAGCCGTGATGCAAGGTGCCGCTGCGGCCGCAACCGAAAAACCTACGCTCAAAGACCTGGTAC
GTGACTTCATCACCATGGCGCTGATTGTCCGTCGCGGCCGCCAGGCGATCTCGGTCACCGCGTTCGAAGC
CAGCGTCGATACTTTCTTCGCCAACCTGGAGCGTCAGGCGCGCAGCGCCAATTACAGCGTCGAACAGGTA
AAAGACGCGCAGTACGCACTGTGCGCATTCCTTGATGAGAGCGTGCTGCGTTCGGGCGACAACGATATGC
GTCGCCACTTCGAAATGGAGCCGCTGCAGTTCCGTTATTTCGGCGTCCACCTGGCGGGCGAAGGCTTCTT
CGAGAAAATCGAACTGCTGCGCGCCGACGTGAAAAAGAACCTGGATGTGCTTGAGGTGTACCACCTGTGC
CTGGCGCTGGGTTTCGAAGGCAAGTTCGGCCTCGGTCAGAAAGACCAATTGCGCTATCTGGCCAACACGC
TGGGCCAGGACATCGCACGCTACCGCAAGACGCCAAAGGCGCTGTCGCCTGACTGGGCATTGCCTGACCA
AGTGTCGCAGATGCTTCGCCATGAAGTTCCGGTATGGCTTTACCTGGTGCTCATCGCCCTCGTGTGCCTG
GGTGTCTATCTGACGCTTGACTGGTTGCTGGGCAAAGACGTGGCCGCATTGGCCGAACAAATCAGCCAAC
TGTTCAATGCTTGA