SecReT6
Protein ID: 71734334
SecReT6 ID55
T6SS typei4b
Gene symbol-
Locus tagPSPPH_0133
StrainPseudomonas syringae pv. phaseolicola 1448A
Repliconchromosome [GenBank: NC_005773] [Browse all T6SS(s) in this replicon]
Location [Strand]156880..158382 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ48Q73
KEGG IDpsp:PSPPH_0133
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.40E-195, Aligned region: 73..495
Protein Sequence: 500 a.a.     [Download]
>gi|71734334|ref|YP_272443.1| unnamed protein product [Pseudomonas syringae pv. phaseolicola 1448A]
MTDKQPVTQQDSALVEVENFAPQSSLLDSIISESRVARSETERTRTRDLIGELVAQVLEGEMTPSKDLIA
VLDARIAEIDSMLSEQMNEIMHAREFQQLEASWRGLKYQVDQTETSTTLKIHLLNASKKDLVRDLKASSE
FDQSALFKKIYEEEYGTFGGAPFGMLLGDYEFNRSPEDMYLLEEISHVAAAAHAPFISAASAELFGWDSF
TDMAGPRDLAKIFDTVEYAKWKSFRASEDSRYVGLTLPHVLGRLPYGPDTTPVEEFNFVESVDGRDHNKY
LWMNAAYALGTRVTDAFSRYGWCVAIRGVEGGGLVEGLPTHTFKTDDGEIALKCPTEIAITDRREKELSD
LGFIPLVHCKGTDYAAFFGTQSTQKQKQYNTDIANANARLSAQLQYIFATSRIAHYMKAIMRDKIGSFAS
RKDVELFLNKWLSSYVLLDDTASQEAKAKFPLREARAEVFEVPGKPGVYKAVTYLRPHYQLDELTASLRL
VAELPQSTRG
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|71733195|ref|NC_005773.3|:c158382-156880 Pseudomonas syringae pv. phaseolicola 1448A chromosome, complete genome
ATGACCGATAAGCAACCCGTGACTCAGCAGGACAGCGCTCTGGTTGAAGTTGAAAACTTCGCCCCGCAAT
CCTCCCTGCTCGACAGCATCATTTCCGAAAGCCGCGTTGCACGCTCCGAAACCGAGCGCACTCGTACCCG
CGATCTGATCGGCGAACTCGTGGCCCAGGTGCTGGAAGGCGAGATGACGCCGAGCAAAGACCTGATTGCC
GTGCTCGACGCGCGCATCGCCGAGATCGATTCGATGCTCTCCGAGCAGATGAACGAAATCATGCACGCCC
GTGAATTCCAGCAACTGGAAGCGTCCTGGCGCGGCCTGAAATATCAGGTTGACCAGACCGAGACCAGCAC
CACGCTGAAGATTCACCTGCTCAATGCGTCGAAAAAAGACCTCGTGCGTGACCTCAAGGCCTCGTCCGAA
TTCGACCAGAGCGCACTGTTCAAGAAGATCTACGAAGAAGAGTACGGCACCTTCGGTGGTGCACCGTTCG
GTATGTTGCTGGGGGACTACGAGTTCAACCGCAGCCCGGAAGACATGTACCTGCTCGAGGAGATCTCCCA
CGTTGCAGCCGCCGCCCACGCGCCGTTCATTTCCGCGGCATCGGCTGAGTTGTTCGGTTGGGACTCGTTC
ACCGACATGGCCGGCCCTCGCGATCTGGCGAAAATCTTCGATACCGTCGAATACGCCAAATGGAAGTCGT
TCCGCGCCTCTGAAGACTCCCGCTATGTCGGCCTGACCCTGCCGCACGTGCTGGGTCGCCTGCCATATGG
TCCGGATACCACGCCCGTCGAAGAATTCAACTTCGTCGAAAGCGTCGATGGCCGTGACCACAACAAATAC
CTGTGGATGAACGCTGCCTACGCACTGGGCACTCGCGTGACCGATGCATTCTCCCGCTACGGCTGGTGTG
TGGCGATCCGCGGCGTGGAAGGCGGCGGTCTGGTCGAAGGCCTGCCGACCCACACCTTCAAGACCGATGA
CGGCGAAATCGCGCTGAAATGCCCGACTGAAATTGCCATCACCGACCGTCGCGAAAAAGAGCTGTCGGAC
CTGGGGTTCATTCCTCTGGTGCACTGCAAAGGCACCGACTACGCCGCATTCTTCGGCACTCAGTCGACCC
AGAAGCAGAAGCAGTACAACACCGACATTGCCAACGCCAACGCGCGTCTTTCGGCGCAACTGCAATACAT
CTTCGCGACCTCGCGTATCGCTCACTACATGAAAGCGATCATGCGCGACAAGATCGGCAGTTTCGCATCG
CGCAAGGATGTCGAGTTGTTCCTCAACAAGTGGCTGTCCAGCTACGTGTTGCTGGATGACACCGCCAGTC
AGGAAGCCAAGGCCAAGTTCCCGTTGCGCGAAGCGCGTGCCGAAGTGTTTGAAGTTCCCGGCAAGCCTGG
CGTCTACAAGGCCGTGACCTACCTGCGTCCGCATTACCAACTGGATGAACTGACAGCATCGTTGCGTCTG
GTCGCCGAATTGCCGCAATCGACTCGCGGCTGA