SecReT6
Protein ID: 71734452
SecReT6 ID55
T6SS typei4b
Gene symbol-
Locus tagPSPPH_0127
StrainPseudomonas syringae pv. phaseolicola 1448A
Repliconchromosome [GenBank: NC_005773] [Browse all T6SS(s) in this replicon]
Location [Strand]148785..150128 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ48Q79
KEGG IDpsp:PSPPH_0127
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.00E-132, Aligned region: 19..445
Protein Sequence: 447 a.a.     [Download]
>gi|71734452|ref|YP_272437.1| unnamed protein product [Pseudomonas syringae pv. phaseolicola 1448A]
MSKQSRVMWSEGMFLLPQHFQYQDEFHQHQLAESTLRSTPFHWGVQTLEVDVEALATGSLQLKRLKLVFP
DGSLYDAPQHDPLPAARDLKNLIKGGEIKVYAALKLPEPFGLNYVEDGQEQKSARRFRKQFDTLPDLNEG
DLENEITSLRLNVVMLVDGDTLDGYSYCPIARLARNSIGGFNLDAHFVHPTLHVGTHETLVGLGRRLISV
LQAKSKALSGRRRERADQIAEFGSSDVTLFWLLNTVNRAYPQLAHLLAHPRLHPERLYLFLAELAGGLLT
FSLDTQLTDIPDYDHQDPAASLVKLDELVRLLLENVIPNQCIVINLSQVRPSYWQGQLLDPRLTEADFYI
SVHADMPGSSLLELVPRAFKVGSPEDIEVVVNSAMPGVTLNHSTRLPNAIPVRLDNHYFSIEPHGRVYER
MMEAQAISFYAPSAFTNLKLELLAVLK
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|71733195|ref|NC_005773.3|:c150128-148785 Pseudomonas syringae pv. phaseolicola 1448A chromosome, complete genome
ATGAGTAAACAAAGCCGCGTGATGTGGTCGGAAGGCATGTTCCTTTTGCCACAACATTTCCAATATCAGG
ATGAGTTTCACCAGCATCAGCTTGCTGAGTCGACACTGCGTTCCACGCCTTTCCATTGGGGCGTGCAAAC
GCTGGAAGTCGACGTCGAGGCATTGGCCACAGGCTCGTTGCAACTGAAGCGCCTGAAGCTGGTGTTCCCT
GACGGCAGCCTTTACGACGCGCCGCAGCACGACCCGCTGCCCGCCGCCCGCGACCTGAAAAATCTGATCA
AGGGTGGAGAAATCAAGGTCTATGCGGCGCTCAAGCTGCCCGAGCCCTTTGGCCTGAACTACGTTGAAGA
TGGCCAGGAACAGAAGAGCGCCCGGCGCTTTCGCAAACAGTTCGACACCCTGCCTGACCTCAACGAAGGC
GATCTGGAAAACGAGATCACCAGCCTGCGTCTGAACGTCGTGATGCTGGTCGATGGCGACACTCTGGATG
GCTACAGTTATTGCCCGATTGCCCGACTGGCACGCAATAGCATCGGCGGTTTCAACCTTGACGCGCATTT
TGTGCATCCTACGTTGCACGTGGGCACCCACGAGACGCTGGTTGGCCTTGGCAGACGCCTGATCAGCGTG
CTGCAAGCCAAGAGCAAGGCACTTTCTGGCCGCCGCCGCGAGCGTGCCGACCAGATCGCCGAGTTCGGTT
CCAGCGACGTTACGTTGTTCTGGCTGCTGAATACGGTCAACCGCGCCTACCCGCAACTGGCCCACCTGCT
GGCGCACCCACGCCTGCATCCAGAGCGGCTGTATCTGTTTCTCGCGGAACTGGCGGGCGGTTTGCTGACG
TTCTCGCTGGACACCCAGCTCACTGACATCCCCGATTACGATCATCAGGACCCGGCGGCCTCGCTGGTGA
AGCTCGACGAACTGGTTCGTCTGCTGCTTGAGAACGTGATTCCGAACCAGTGCATCGTCATCAATCTGAG
CCAGGTCCGGCCTTCGTACTGGCAGGGCCAATTGCTCGACCCACGCCTTACCGAAGCGGATTTCTATATT
TCAGTGCATGCCGACATGCCCGGCTCCAGCCTGCTGGAACTGGTGCCGCGTGCGTTCAAGGTCGGCTCGC
CGGAAGACATCGAGGTGGTCGTCAACAGCGCCATGCCGGGCGTCACCCTGAACCACTCGACACGCCTGCC
AAACGCCATTCCGGTGCGCCTGGACAACCATTACTTCTCCATCGAGCCACATGGCCGGGTGTACGAACGC
ATGATGGAAGCCCAGGCCATTTCCTTCTACGCGCCCAGCGCGTTTACCAATCTCAAGCTTGAACTGTTGG
CGGTGCTTAAATGA