SecReT6
Protein ID: 71734592
SecReT6 ID55
T6SS typei4b
Gene symbol-
Locus tagPSPPH_0134
StrainPseudomonas syringae pv. phaseolicola 1448A
Repliconchromosome [GenBank: NC_005773] [Browse all T6SS(s) in this replicon]
Location [Strand]158397..158930 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ48Q72
KEGG IDpsp:PSPPH_0134
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.80E-60, Aligned region: 11..165
Protein Sequence: 177 a.a.     [Download]
>gi|71734592|ref|YP_272444.1| unnamed protein product [Pseudomonas syringae pv. phaseolicola 1448A]
MAKKESTQHKLDRVRAPRVHITYDVDIGDAQEKKELPFVVGVLGDFSGNPLEPLPKLKDRKFIFIDRDNF
NGVLKGIKPRLAYRVDNTLAKNGTQLGVELNFNALEDFEPQNVVRQVEPLRKLLEVRNKLADLRNKMGGN
DKLEELLMDVLQNTEKLKTLGKEFGREAAVPATDSKE
 
Nucleotide Sequence: 534 bp     [Download]
>gi|71733195|ref|NC_005773.3|:c158930-158397 Pseudomonas syringae pv. phaseolicola 1448A chromosome, complete genome
ATGGCGAAGAAGGAAAGTACCCAGCACAAACTTGACCGCGTTCGCGCGCCTCGGGTCCATATCACTTACG
ACGTTGATATCGGCGACGCTCAGGAAAAGAAAGAGCTGCCATTCGTTGTAGGCGTTCTCGGCGATTTCTC
CGGCAACCCCCTGGAGCCGCTGCCCAAGCTCAAGGATCGCAAGTTCATCTTCATCGATCGCGACAACTTC
AACGGCGTCCTTAAAGGCATCAAGCCGCGCCTGGCGTATCGCGTCGACAACACCCTGGCCAAGAACGGTA
CTCAGCTTGGCGTCGAATTGAACTTCAATGCACTGGAAGACTTCGAGCCGCAGAACGTCGTGCGTCAGGT
CGAGCCGCTGCGCAAGCTGCTGGAAGTGCGCAACAAGCTGGCTGACCTGCGTAACAAGATGGGTGGCAAC
GACAAGCTTGAAGAACTGCTGATGGACGTGTTGCAGAACACTGAAAAGCTGAAAACCCTGGGCAAGGAGT
TCGGCCGTGAAGCCGCCGTTCCTGCCACCGACAGCAAAGAGTAA