SecReT6
Protein ID: 71735418
SecReT6 ID55
T6SS typei4b
Gene symbol-
Locus tagPSPPH_0131
StrainPseudomonas syringae pv. phaseolicola 1448A
Repliconchromosome [GenBank: NC_005773] [Browse all T6SS(s) in this replicon]
Location [Strand]154540..156372 [-]
ProductImpG
NoteTssF
UniProt IDQ48Q75
KEGG IDpsp:PSPPH_0131
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.20E-209, Aligned region: 5..610
Protein Sequence: 610 a.a.     [Download]
>gi|71735418|ref|YP_272441.1| unnamed protein product [Pseudomonas syringae pv. phaseolicola 1448A]
MLDDLLPYYEKELSHLRFLGQEFAAQYPKIASRLLIEGDNCEDPHTERLIEAFSFLSARVHKKLDDEFPE
IVESFLEVLYPHYLRPTPSMSIVEFNMGKQEKVTESYRVARHTELHATPIDGIVCKFRTCYPVELWPVAV
QSASFIEMERSAFNGHSADLIARLRIGLGATSDVLFGKMELDRLRFFLDGESTLMHQLYELLFNNLAKAT
LSFEDEGRIREVVLPADALKSVGYGLDEGLVDYSERSFLGYRLLHEYFTFPDKFMFFDLSGFARILAGKE
IAKVEINFYFSDYDLTDRLARLTQNIGRNNFKLNCTPIINLFRQQAEPIKLTHVQHEYAVTPDVRLQSSA
EVVSIDRVRRVKKINGNDQVGTCHPFFEPRGDQGPGQSFWIARRRPTQSRQSDGSNMFIRVVDRDLELID
SNNDTLSIRLTCSNRDLPLMLPFGGERGDFNIPSNSVIKDIRCLRKPTATVRVPLGNGVIWRLISHLSLN
HMSLVSKGREVLLELLSLYNYRNVSAIRKQINGIVSVSSEPVVARIGHPRPNFVRGVGITLKFDESQYTG
SGVFLFGMVLDHFFGQYCSMNSFTQLTLRTVQREKRVVQWPPRTGDQPLV
 
Nucleotide Sequence: 1833 bp     [Download]
>gi|71733195|ref|NC_005773.3|:c156372-154540 Pseudomonas syringae pv. phaseolicola 1448A chromosome, complete genome
ATGCTCGACGATCTGCTGCCCTATTACGAGAAGGAACTCTCGCACCTGCGCTTTCTGGGCCAGGAATTTG
CCGCTCAATATCCGAAGATCGCTTCGCGATTACTGATTGAGGGCGACAACTGCGAAGACCCGCACACCGA
GCGCCTTATCGAGGCGTTCTCGTTCCTGTCGGCGCGCGTACACAAGAAACTCGACGATGAGTTTCCTGAA
ATCGTCGAGTCGTTTCTGGAGGTGCTGTACCCGCACTACCTGCGCCCTACCCCTTCGATGTCCATCGTCG
AGTTCAACATGGGCAAGCAGGAAAAGGTCACCGAATCCTATCGCGTAGCCCGGCACACCGAGCTGCATGC
CACACCGATAGACGGAATAGTGTGCAAGTTTCGTACGTGCTACCCGGTCGAACTGTGGCCAGTGGCAGTG
CAAAGTGCTTCGTTCATTGAAATGGAGCGTTCGGCGTTCAACGGCCACAGTGCAGACCTGATTGCGCGCT
TGCGCATCGGCCTGGGTGCGACCTCCGACGTCCTGTTCGGCAAGATGGAACTGGACCGACTGCGCTTTTT
CCTTGATGGCGAAAGCACGCTGATGCATCAACTGTATGAGCTGCTGTTCAACAACCTGGCCAAAGCGACC
CTGTCGTTCGAAGACGAAGGGCGCATTCGTGAAGTGGTGCTGCCCGCCGACGCCCTGAAGTCTGTCGGTT
ATGGTCTGGATGAAGGGCTGGTGGATTACTCGGAGCGTTCGTTTCTGGGTTATCGACTGCTGCACGAATA
CTTCACCTTCCCTGACAAGTTCATGTTCTTCGACCTGTCAGGCTTTGCCCGTATTCTGGCTGGCAAAGAG
ATCGCCAAAGTGGAAATCAATTTCTACTTTTCCGACTACGACCTGACGGATCGTCTGGCACGCCTGACCC
AGAACATCGGCCGTAACAATTTCAAGCTCAACTGCACGCCCATCATCAACCTGTTCCGCCAGCAGGCCGA
GCCGATCAAGCTGACCCACGTCCAGCATGAATACGCGGTGACACCGGATGTTCGCCTGCAAAGCTCTGCC
GAAGTGGTCTCTATCGATCGCGTGCGGCGGGTGAAGAAGATCAATGGCAACGATCAGGTCGGCACCTGCC
ATCCGTTCTTTGAACCACGCGGTGATCAAGGCCCCGGTCAGAGCTTCTGGATCGCCCGGCGACGTCCGAC
GCAGAGCCGACAAAGCGATGGCTCGAACATGTTCATCCGCGTCGTGGATCGGGATCTGGAACTGATTGAT
TCCAACAACGACACACTCAGTATCCGCCTGACGTGCAGCAACCGCGATTTGCCACTGATGCTGCCTTTTG
GCGGCGAGCGCGGGGACTTCAACATTCCCTCCAACTCGGTGATCAAGGACATCCGCTGCCTGCGCAAACC
GACGGCGACGGTGCGCGTGCCGCTGGGCAACGGCGTGATCTGGCGGCTCATCTCGCACCTGTCGCTGAAC
CACATGTCGCTGGTTTCGAAGGGGCGCGAAGTGCTGTTGGAACTGCTGTCGCTTTACAACTACCGCAACG
TGTCGGCGATTCGCAAACAGATCAACGGGATCGTTTCGGTGAGCAGCGAGCCGGTCGTGGCACGCATCGG
CCATCCGCGGCCGAACTTTGTGCGCGGCGTCGGTATTACGCTGAAGTTCGATGAAAGCCAGTACACCGGC
AGCGGCGTGTTCCTGTTCGGCATGGTCCTTGACCACTTCTTTGGTCAGTACTGCTCGATGAACAGCTTTA
CCCAATTAACCCTTCGCACCGTGCAGCGCGAAAAGAGAGTGGTCCAATGGCCCCCGCGAACAGGCGATCA
ACCCCTGGTCTGA