SecReT6
Protein ID: 71736251
SecReT6 ID55
T6SS typei4b
Gene symbol-
Locus tagPSPPH_0132
StrainPseudomonas syringae pv. phaseolicola 1448A
Repliconchromosome [GenBank: NC_005773] [Browse all T6SS(s) in this replicon]
Location [Strand]156372..156854 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ48Q74
KEGG IDpsp:PSPPH_0132
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 6.50E-17, Aligned region: 34..136
Protein Sequence: 160 a.a.     [Download]
>gi|71736251|ref|YP_272442.1| unnamed protein product [Pseudomonas syringae pv. phaseolicola 1448A]
MSSQHKLLPSLLDRLLDDRPHQSVESSSQRLSSLADYKASIVRDLEILVNTRQSLVANELEGFANLSGTI
LDYGMPDFTSRSVLDPQDRLLIQRQLEKAISVGDRRFRSVKVQLLAQQTGQRMLTFRVDAVLRLQDISRQ
VSFDAVLQVNTQEYKVQNLN
 
Nucleotide Sequence: 483 bp     [Download]
>gi|71733195|ref|NC_005773.3|:c156854-156372 Pseudomonas syringae pv. phaseolicola 1448A chromosome, complete genome
ATGAGTAGTCAACACAAGCTGTTGCCTTCATTGCTGGATCGGTTGCTCGACGATCGTCCGCATCAGTCCG
TGGAATCGTCATCGCAACGGTTGAGTTCGCTGGCCGATTACAAGGCCAGCATCGTTCGTGACCTGGAGAT
TCTGGTGAACACTCGCCAGTCTCTGGTCGCTAACGAGCTGGAGGGTTTCGCCAATCTGAGCGGCACCATC
CTCGATTACGGTATGCCCGACTTCACCAGTAGAAGCGTGCTCGACCCACAGGACCGTCTTTTGATTCAGC
GCCAGCTGGAGAAGGCAATTTCTGTCGGTGACCGACGTTTCCGCAGCGTGAAAGTCCAGTTGCTTGCACA
ACAGACCGGCCAGCGCATGCTGACTTTTCGTGTGGACGCAGTACTGCGTCTGCAGGACATTTCGCGTCAG
GTTTCCTTTGACGCCGTGCTGCAGGTCAACACTCAGGAATACAAAGTGCAGAACCTCAACTGA