SecReT6
Protein ID: 71736516
SecReT6 ID55
T6SS typei4b
Gene symbolclpB1
Locus tagPSPPH_0129
StrainPseudomonas syringae pv. phaseolicola 1448A
Repliconchromosome [GenBank: NC_005773] [Browse all T6SS(s) in this replicon]
Location [Strand]150906..153509 [-]
ProductATP-dependent Clp protease ATP-binding subunit
NoteTssH
UniProt IDQ48Q77
KEGG IDpsp:PSPPH_0129
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 9.80E-44, Aligned region: 225..242
AAA_2 [PF07724], Evalue: 9.80E-44, Aligned region: 598..765
AAA_2 [PF07724], Evalue: 9.80E-44, Aligned region: 819..839
AAA [PF00004], Evalue: 2.40E-19, Aligned region: 38..66
AAA [PF00004], Evalue: 2.40E-19, Aligned region: 225..338
AAA [PF00004], Evalue: 2.40E-19, Aligned region: 604..724
AAA [PF00004], Evalue: 2.40E-19, Aligned region: 776..803
AAA_5 [PF07728], Evalue: 3.00E-14, Aligned region: 225..245
AAA_5 [PF07728], Evalue: 3.00E-14, Aligned region: 299..355
AAA_5 [PF07728], Evalue: 3.00E-14, Aligned region: 603..724
ClpB_D2-small [PF10431], Evalue: 1.50E-13, Aligned region: 775..845
AAA_16 [PF13191], Evalue: 4.00E-10, Aligned region: 202..256
AAA_16 [PF13191], Evalue: 4.00E-10, Aligned region: 270..303
AAA_16 [PF13191], Evalue: 4.00E-10, Aligned region: 468..468
AAA_16 [PF13191], Evalue: 4.00E-10, Aligned region: 598..646
AAA_16 [PF13191], Evalue: 4.00E-10, Aligned region: 668..692
AAA_16 [PF13191], Evalue: 4.00E-10, Aligned region: 788..810
AAA_22 [PF13401], Evalue: 4.00E-10, Aligned region: 224..311
AAA_22 [PF13401], Evalue: 4.00E-10, Aligned region: 342..397
AAA_22 [PF13401], Evalue: 4.00E-10, Aligned region: 601..646
Clp_N [PF02861], Evalue: 1.70E-08, Aligned region: 21..73
Clp_N [PF02861], Evalue: 1.70E-08, Aligned region: 103..127
Arch_ATPase [PF01637], Evalue: 2.20E-06, Aligned region: 204..239
Arch_ATPase [PF01637], Evalue: 2.20E-06, Aligned region: 278..382
Arch_ATPase [PF01637], Evalue: 2.20E-06, Aligned region: 602..647
Sigma54_activat [PF00158], Evalue: 5.70E-06, Aligned region: 221..240
Sigma54_activat [PF00158], Evalue: 5.70E-06, Aligned region: 603..721
AAA_19 [PF13245], Evalue: 8.30E-06, Aligned region: 225..246
AAA_19 [PF13245], Evalue: 8.30E-06, Aligned region: 601..625
AAA_14 [PF13173], Evalue: 1.20E-05, Aligned region: 225..357
AAA_14 [PF13173], Evalue: 1.20E-05, Aligned region: 354..391
AAA_14 [PF13173], Evalue: 1.20E-05, Aligned region: 602..684
IstB_IS21 [PF01695], Evalue: 2.00E-05, Aligned region: 219..249
IstB_IS21 [PF01695], Evalue: 2.00E-05, Aligned region: 603..624
AAA_17 [PF13207], Evalue: 6.80E-05, Aligned region: 225..293
AAA_17 [PF13207], Evalue: 6.80E-05, Aligned region: 604..641
AAA_25 [PF13481], Evalue: 0.00026, Aligned region: 225..249
AAA_25 [PF13481], Evalue: 0.00026, Aligned region: 350..385
AAA_25 [PF13481], Evalue: 0.00026, Aligned region: 601..624
NACHT [PF05729], Evalue: 0.00029, Aligned region: 225..252
NACHT [PF05729], Evalue: 0.00029, Aligned region: 603..628
Zeta_toxin [PF06414], Evalue: 0.00086, Aligned region: 220..243
Zeta_toxin [PF06414], Evalue: 0.00086, Aligned region: 597..643
AAA_29 [PF13555], Evalue: 0.00092, Aligned region: 218..241
AAA_29 [PF13555], Evalue: 0.00092, Aligned region: 601..628
AAA_18 [PF13238], Evalue: 0.0023, Aligned region: 225..245
AAA_18 [PF13238], Evalue: 0.0023, Aligned region: 605..628
AAA_30 [PF13604], Evalue: 0.0063, Aligned region: 212..287
AAA_30 [PF13604], Evalue: 0.0063, Aligned region: 602..634
T2SE [PF00437], Evalue: 0.0096, Aligned region: 192..241
T2SE [PF00437], Evalue: 0.0096, Aligned region: 600..643
Protein Sequence: 867 a.a.     [Download]
>gi|71736516|ref|YP_272439.1| clpB1 gene product [Pseudomonas syringae pv. phaseolicola 1448A]
MNLKSLFAKLNETSRTATESAAALCLSENHYDVEVEHLLLQLLDNNDNDLPVILRHYDVVPDRLQAQLVT
ALGTFKKGNTRTPALSPHITRMIEQAWVLASIEFGQSQIRTGHLIQALLDDDALRRVVIGSAPELEKINA
DDLRLNMSALVEGSPETKLSKPLANADASTGATTKGNGKPPALDQYTVNLTQSARDGRIDPVLGREFEVR
QMVDILTRRRQNNPILTGEAGVGKTAVVEGLALRIVQGDVPSVLKGVAIHTLDLGLLQAGAGVKGEFENR
LKSVIEETKRSLHPIILFIDEAHTLIGSGGQAGQNDAANLLKPALARGELRTIAATTWAEYKKYFEKDAA
LARRFQVVKVEEPDEDKAIHMLRGLLAKMQEHHKVTVMDEALVQAVRLSNRYITGRQLPDKAVSVLDTAC
ARVALGQSAQPGALEDCKRHIDNLNAEITVLEQETAKGSDHARRLTALHEELKAEQETRESLEQQWKREL
ELVEKLGALSVPEDGAPDAEQIAAVRAELASVQGEQPLVHALVDGGTIGEVISGWTGIPLGKMLRDEIDT
VQSLPALLGERVLGQDHALEEIGKRIKISRARMEDPNKPIGVFLLLGPSGVGKTETALALADTLYGGERN
VITINMSEYQEAHTVSSLKGSPPGYVGYGEGGVLTEAVRRKPYSVVLLDEVEKAHPDVLELFFQVFDKGV
LDDGEGREINFRNTVIILTSNTGTDRIMQWCLNTEQKPTPDDIVEGLRDELNQVFKPAFLGRLTIVPYYP
VQDAILERIVGLKLERIRKRFERNHQAVLRYDEALIKAIASRCTEVDSGARNIDNILSKTLMPELAQRVL
ERMAQDKPIQSLTIDLGSDGDFAYTLT
 
Nucleotide Sequence: 2604 bp     [Download]
>gi|71733195|ref|NC_005773.3|:c153509-150906 Pseudomonas syringae pv. phaseolicola 1448A chromosome, complete genome
GTGAACCTGAAGTCCCTGTTCGCCAAGCTGAACGAAACGAGCCGCACTGCCACTGAAAGCGCTGCTGCGC
TGTGCCTGTCGGAGAACCACTACGACGTTGAAGTCGAGCACTTGCTGCTGCAATTGCTCGACAACAACGA
TAACGACCTGCCGGTGATCCTGCGCCACTACGACGTAGTGCCTGATCGCCTGCAAGCACAGCTGGTCACC
GCGCTGGGGACGTTCAAGAAAGGCAACACACGGACGCCTGCGCTCTCGCCGCACATCACGCGCATGATCG
AGCAGGCCTGGGTACTGGCGTCGATCGAATTCGGTCAGTCGCAGATCCGCACCGGCCACCTGATTCAGGC
CTTGCTGGATGACGATGCCCTGCGCCGCGTGGTCATCGGTTCGGCGCCGGAACTGGAGAAAATCAACGCT
GACGACCTGCGCCTGAATATGAGCGCGCTGGTCGAAGGCAGCCCGGAGACCAAACTGAGCAAGCCTCTGG
CCAACGCCGACGCAAGCACGGGCGCAACCACCAAGGGCAACGGCAAGCCCCCTGCCCTGGACCAGTACAC
CGTCAACCTGACCCAGAGCGCCCGCGATGGTCGTATCGATCCGGTACTGGGACGCGAGTTCGAAGTGCGG
CAGATGGTCGACATCCTGACCCGCCGCCGTCAGAACAACCCGATCCTGACTGGTGAAGCGGGTGTGGGTA
AAACAGCCGTGGTGGAAGGTCTGGCGCTGCGCATCGTGCAGGGCGACGTGCCTTCGGTGCTCAAGGGCGT
CGCCATTCACACCCTGGATCTGGGCCTGTTGCAGGCCGGTGCAGGGGTCAAAGGCGAGTTCGAAAACCGC
CTCAAGTCGGTCATCGAAGAAACCAAGCGCAGCCTGCACCCGATCATTCTGTTCATCGACGAAGCCCACA
CGTTGATCGGCTCGGGTGGCCAGGCCGGGCAGAACGACGCAGCGAACCTGCTCAAGCCTGCCTTGGCGCG
TGGCGAGCTGCGCACCATCGCCGCCACTACATGGGCAGAATACAAAAAGTATTTCGAAAAAGACGCCGCA
TTGGCTCGACGCTTCCAGGTCGTGAAAGTCGAAGAGCCTGACGAAGACAAGGCCATCCACATGCTTCGTG
GGCTGCTGGCGAAGATGCAGGAGCATCACAAGGTCACCGTGATGGACGAAGCGCTGGTGCAGGCCGTACG
CCTTTCCAATCGCTACATCACCGGCCGCCAATTGCCGGACAAAGCCGTCAGCGTGCTGGACACCGCTTGC
GCACGCGTCGCGCTGGGCCAATCGGCGCAGCCAGGCGCGCTGGAAGACTGCAAGCGCCACATCGACAACC
TGAATGCAGAAATCACCGTGCTGGAGCAGGAAACCGCCAAGGGCAGCGACCACGCTCGCCGTTTGACGGC
CCTGCACGAAGAGCTGAAAGCCGAACAGGAAACCCGCGAGTCGCTGGAGCAACAGTGGAAGCGCGAGCTG
GAACTGGTCGAAAAGCTTGGCGCACTCAGCGTTCCGGAAGACGGCGCGCCTGATGCTGAGCAGATCGCTG
CAGTGCGTGCCGAACTGGCCAGTGTGCAGGGCGAGCAACCGCTGGTCCACGCGCTGGTAGACGGCGGCAC
CATCGGTGAAGTGATTTCCGGCTGGACCGGTATCCCGCTGGGCAAGATGCTGCGCGACGAGATCGATACC
GTACAAAGCCTGCCGGCGCTGTTGGGTGAACGCGTACTGGGGCAGGATCATGCGCTTGAAGAGATCGGCA
AGCGCATCAAGATTTCCCGCGCGCGCATGGAAGACCCGAACAAGCCGATCGGTGTGTTCCTGCTGCTCGG
CCCGAGCGGTGTCGGCAAGACCGAAACTGCGCTGGCGCTGGCTGACACACTGTATGGCGGCGAGCGTAAC
GTCATCACCATCAACATGTCCGAATACCAGGAAGCCCACACAGTCTCCAGCCTCAAAGGCTCCCCGCCGG
GCTACGTCGGTTATGGCGAAGGTGGCGTGCTGACCGAAGCCGTGCGCCGCAAGCCTTACAGCGTGGTGCT
GCTCGACGAGGTGGAGAAAGCCCACCCGGACGTGCTCGAGCTGTTTTTCCAGGTCTTCGACAAAGGCGTG
CTGGACGATGGCGAAGGTCGCGAGATCAACTTCCGCAATACCGTGATCATTCTCACCTCCAACACCGGTA
CTGATCGCATCATGCAGTGGTGCCTGAACACCGAGCAGAAGCCAACCCCCGATGACATCGTGGAAGGCCT
GCGCGACGAGCTGAATCAGGTGTTCAAACCTGCGTTCCTCGGTCGCTTGACCATCGTGCCGTACTACCCG
GTTCAAGACGCGATTCTGGAACGCATTGTCGGCCTGAAACTTGAGCGCATCCGCAAGCGTTTCGAGCGCA
ATCACCAGGCAGTGCTGCGTTACGACGAGGCGCTGATCAAGGCCATCGCATCGCGTTGCACGGAAGTCGA
CAGCGGCGCACGCAACATCGACAACATCCTGTCCAAAACCCTCATGCCGGAACTCGCCCAGCGAGTGCTG
GAGCGGATGGCGCAGGACAAGCCGATTCAGAGCCTGACCATCGATCTGGGCAGCGATGGCGACTTCGCTT
ACACACTGACCTGA