SecReT6
Protein ID: 71737480
SecReT6 ID55
T6SS typei4b
Gene symbol-
Locus tagPSPPH_0122
StrainPseudomonas syringae pv. phaseolicola 1448A
Repliconchromosome [GenBank: NC_005773] [Browse all T6SS(s) in this replicon]
Location [Strand]140006..140524 [-]
Producthypothetical protein
NoteTssD
UniProt IDQ48Q84
KEGG IDpsp:PSPPH_0122
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.60E-41, Aligned region: 6..146
Protein Sequence: 172 a.a.     [Download]
>gi|71737480|ref|YP_272432.1| unnamed protein product [Pseudomonas syringae pv. phaseolicola 1448A]
MAFDAYIQIDGIPGEVLDDKHKDWIEVLGYEFGATQATSATASSSGGASSERVALSDFSIRKSVDKASAK
LFEACCKGTHIAKIQLNVNRAGGDKLTYLTINLEEVVVSSVKAVAGGNQKGEDNAVSDLPIEEISFNFAR
IKTTYTQQSRSDGQGGGNVTGGWDRTANKVFA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|71733195|ref|NC_005773.3|:c140524-140006 Pseudomonas syringae pv. phaseolicola 1448A chromosome, complete genome
ATGGCATTTGACGCATACATCCAAATCGACGGCATCCCGGGCGAAGTTCTGGACGACAAGCACAAAGACT
GGATCGAAGTGCTCGGCTACGAGTTCGGCGCTACCCAGGCCACCTCCGCCACCGCCAGCTCGTCGGGCGG
TGCTTCGTCCGAGCGCGTTGCACTGAGCGACTTCAGCATCCGCAAATCTGTGGACAAGGCTTCTGCCAAG
CTGTTCGAAGCGTGCTGCAAAGGCACTCACATCGCCAAGATCCAGCTGAACGTCAACCGTGCTGGCGGCG
ACAAGCTGACCTACCTGACCATCAACCTGGAAGAAGTCGTTGTGTCTTCCGTGAAGGCTGTAGCAGGCGG
CAACCAGAAAGGCGAAGACAACGCCGTCAGCGATCTGCCGATTGAAGAAATCAGCTTCAACTTCGCTCGC
ATCAAGACTACCTACACCCAACAGAGCCGTTCCGATGGCCAGGGTGGCGGTAACGTCACTGGCGGCTGGG
ACCGCACTGCGAACAAAGTATTCGCATAA