SecReT6
Protein ID: 71737889
SecReT6 ID55
T6SS typei4b
Gene symbol-
Locus tagPSPPH_0130
StrainPseudomonas syringae pv. phaseolicola 1448A
Repliconchromosome [GenBank: NC_005773] [Browse all T6SS(s) in this replicon]
Location [Strand]153506..154576 [-]
ProductImpH
NoteTssG
UniProt IDQ48Q76
KEGG IDpsp:PSPPH_0130
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.30E-104, Aligned region: 17..333
Protein Sequence: 356 a.a.     [Download]
>gi|71737889|ref|YP_272440.1| unnamed protein product [Pseudomonas syringae pv. phaseolicola 1448A]
MAPANRRSTPGLIDQARAEPHRFEFFQLVRLLRLHYSRNGRMDLETRPHEDPLRFRSQLSLNFPASEVSD
LQFEREGKLSAAGLPLSEVQVTFMGLVGPSGVLPRPYTELLIDRHIQYRDDAAHAFLDIFSHRMTTLFYE
AWQKYKFYIEYERNGTSNFDRYLLNLVGFGPEALKQKFDKGESPLRRELFSYFSGMFAQKPRNALNLEVM
LSFYFSLPFKIQQFAGRWLKLDSSQCTQLGRKNAVLGQSAVAGNRVWDYQSCVRIEMGPLELADYQRFQP
GTEDYQKLVELVRFYIGAELDFQIAPKLKREAVPVARLGRQGNVSLGWLGWLKRPGVDVEPSRCAVFHIP
FDGVSL
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|71733195|ref|NC_005773.3|:c154576-153506 Pseudomonas syringae pv. phaseolicola 1448A chromosome, complete genome
ATGGCCCCCGCGAACAGGCGATCAACCCCTGGTCTGATTGACCAGGCAAGGGCTGAGCCGCACCGATTCG
AATTTTTTCAGTTGGTGCGTTTGCTTCGCCTGCATTACAGCAGGAATGGGCGCATGGACCTGGAAACCAG
GCCGCATGAGGACCCTCTGCGCTTTCGTTCGCAGCTGTCGCTGAACTTTCCGGCCAGTGAAGTCAGCGAC
CTGCAGTTCGAACGCGAAGGCAAGCTCTCGGCGGCCGGTTTGCCGCTGTCCGAGGTGCAGGTCACGTTCA
TGGGCCTGGTCGGCCCATCAGGCGTGCTGCCGCGGCCGTACACCGAGCTACTCATCGATAGGCATATTCA
GTACCGAGACGACGCTGCGCATGCGTTTCTGGATATTTTTTCGCATCGCATGACCACGCTGTTTTACGAG
GCCTGGCAGAAGTACAAGTTTTACATCGAGTACGAGCGTAACGGCACGTCGAACTTTGATCGTTATTTGC
TCAACCTGGTGGGTTTCGGCCCCGAAGCCTTGAAGCAAAAGTTCGACAAGGGCGAGTCGCCATTGCGTCG
CGAACTGTTCAGCTACTTCTCGGGGATGTTCGCCCAGAAGCCGCGCAACGCCCTGAACCTTGAAGTCATG
CTGAGTTTTTATTTCTCGCTGCCGTTCAAGATCCAGCAGTTCGCCGGGCGCTGGCTGAAGCTCGACAGCA
GCCAGTGCACGCAGTTGGGCCGCAAGAACGCCGTGCTAGGGCAGAGCGCCGTGGCTGGCAATCGCGTCTG
GGATTACCAGTCGTGCGTACGTATCGAAATGGGGCCTCTGGAACTGGCTGACTACCAGCGCTTTCAGCCG
GGCACCGAGGATTACCAGAAGCTTGTTGAGCTGGTGCGTTTTTACATCGGCGCCGAACTGGACTTCCAGA
TTGCGCCGAAGCTCAAGCGCGAAGCTGTACCCGTGGCCCGCTTGGGCCGCCAAGGCAATGTATCGCTGGG
CTGGCTTGGCTGGCTCAAACGCCCCGGTGTCGACGTGGAGCCCTCCCGTTGCGCTGTTTTCCATATTCCT
TTTGATGGGGTCTCCCTGTGA