SecReT6
Protein ID: 71907791
SecReT6 ID87
T6SS typei4b
Gene symbol-
Locus tagDaro_2169
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T6SS(s) in this replicon]
Location [Strand]2339770..2342571 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ47E23
KEGG IDdar:Daro_2169
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.10E-66, Aligned region: 53..367
Phage_GPD [PF05954], Evalue: 2.10E-66, Aligned region: 596..688
DUF2345 [PF10106], Evalue: 1.40E-45, Aligned region: 730..892
T6SS_Vgr [PF13296], Evalue: 6.50E-33, Aligned region: 525..568
T6SS_Vgr [PF13296], Evalue: 6.50E-33, Aligned region: 576..680
Phage_base_V [PF04717], Evalue: 4.00E-19, Aligned region: 422..524
Protein Sequence: 933 a.a.     [Download]
>gi|71907791|ref|YP_285378.1| Rhs element Vgr protein [Dechloromonas aromatica RCB]
MTMNSFLDLISGGAAWRQTDRLLTLTTPAGPDALLAETASIDEALGPVAEHAGYRIQLTVLTANAEQSLT
ALLGQPARLDLQTSALRTVRRPFHGHITQVTRLGANGGFARYKLIIEPWLAFLGHNQDNYLFQDKSVIEI
IDELLGDWKSQGKLVPDWRWVLADTAAYPKRGMTVQYRESDLAFLKRLLAEEGLFCWFEHQAEEGDTLGK
HTLIIADHNGAFTDNTQPRIRFTQAGATLSEDSLDRWHGLRQLDTVETNASSWDYRSLSTRPQGARSSID
SGSLPKTAAWHDPGQYAWQNSAHGERMLGNQRQAIDARMKQFDGQGTVRSAAPGTTFRLADHPEHDLDAP
EQRKFLITAVSHQARNNLDETVNGEQGREQGSEQSVDLYRNQITAIRASIPWRPLSSDSHGRNIHPRPTI
NGTLTAVVVGNGQPTHTDRDRRVRVQFPWQRGAQSAGRSEHPTGADNGPASDALGVWLRVMTPVAGANWG
GHMTPRPGQEVLVAFQNGNIDRPIIIGTVYNGSGNTDAQGNQQAGSTLQASANAPAFFAGKEAEAHTHNA
SLSGLKSQQLNASKTGQGGYNQLVFDDTPGESRIEVSTTEYQSILQLGHLKQQSDNARQADRGHGAELAT
QSASAIRAGNGLLISADARPNASSSHLDSREPIAQTQDAQSLTQSLAEVAAKQNAALKGDPQADKLPASE
ALKHAIDVMSATATQGQTQAGSDTIKATLGGTGTVPAWSEPRIQYSAPAGIAQLTPQNHILAAGKHLSIA
TGQDTNLIAQGHHSLSVKDGIALFTVGKAKGKNKPNTETGIHLHAASGSVSLQSQSGKTTGAADKKVTIA
STTGNLNASAKQHILAMAQGAYLKIEGGNISLHAPGKVELKASQKNLTGPKSASTNLPAWNVGELNLANS
PERKATCLQAASRSGAAFVQLDK
 
Nucleotide Sequence: 2802 bp     [Download]
>gi|71905642|ref|NC_007298.1|:c2342571-2339770 Dechloromonas aromatica RCB, complete genome
ATGACCATGAACAGCTTCCTAGATCTGATTTCCGGCGGCGCCGCCTGGCGCCAGACCGACCGGCTACTGA
CGCTGACCACGCCGGCCGGGCCGGATGCCTTGCTGGCCGAAACGGCCAGCATTGACGAAGCCCTCGGCCC
GGTTGCAGAGCACGCCGGTTATCGCATCCAATTAACGGTTCTGACGGCCAACGCCGAGCAATCCCTGACC
GCCTTGCTCGGCCAGCCAGCCCGTCTGGACCTGCAAACCAGTGCCTTGCGCACAGTGCGGCGGCCTTTCC
ACGGTCACATTACGCAAGTCACCCGTCTTGGTGCCAACGGCGGTTTCGCCCGTTACAAACTGATCATCGA
ACCCTGGCTCGCCTTCCTTGGCCACAATCAGGACAACTACCTGTTTCAGGACAAGAGCGTCATCGAGATC
ATTGACGAACTGCTCGGCGACTGGAAGTCCCAAGGCAAGCTCGTTCCCGACTGGCGCTGGGTCCTGGCTG
ACACCGCCGCTTACCCCAAGCGCGGCATGACCGTGCAATACCGCGAAAGCGATCTCGCTTTCCTCAAGCG
TCTGCTGGCCGAAGAGGGGTTGTTCTGCTGGTTCGAACACCAGGCTGAAGAAGGCGACACCCTGGGTAAG
CACACCCTGATCATCGCTGACCATAACGGTGCCTTCACCGATAACACGCAACCCCGCATCCGCTTCACCC
AGGCCGGCGCAACGCTCTCCGAAGACAGTCTCGACCGCTGGCACGGCCTGCGCCAGCTCGACACCGTCGA
AACCAACGCCAGCAGTTGGGATTACCGCAGCCTCTCGACCCGGCCGCAAGGCGCCCGCAGCAGTATCGAC
AGCGGCAGCCTACCCAAGACCGCTGCCTGGCACGACCCCGGCCAATACGCCTGGCAGAACAGCGCCCACG
GCGAACGTATGCTCGGCAACCAACGCCAAGCTATCGATGCGCGAATGAAACAATTCGACGGCCAAGGCAC
CGTCCGTAGCGCCGCCCCCGGCACCACCTTCAGGCTGGCCGACCACCCCGAACACGACCTCGACGCCCCG
GAACAACGCAAGTTCCTGATCACCGCCGTCAGCCACCAAGCTCGTAATAATCTGGACGAAACCGTCAATG
GCGAACAAGGCCGGGAGCAGGGCAGCGAACAAAGCGTCGACCTCTACCGCAACCAGATCACCGCCATCCG
TGCCAGCATCCCCTGGCGCCCCTTGAGCTCGGACAGCCACGGCCGGAACATCCACCCGCGCCCGACCATC
AACGGCACGCTGACCGCTGTCGTCGTCGGCAACGGCCAACCCACCCACACCGACCGTGACAGGCGCGTCC
GCGTCCAGTTCCCCTGGCAACGTGGTGCCCAATCCGCCGGGCGCAGCGAACACCCCACCGGCGCGGACAA
CGGTCCGGCCAGCGACGCCCTTGGCGTCTGGCTCCGCGTCATGACCCCCGTCGCCGGTGCCAACTGGGGC
GGCCACATGACCCCGCGCCCCGGCCAGGAAGTCCTCGTCGCCTTCCAGAACGGCAACATCGACCGCCCGA
TCATCATCGGCACCGTCTACAACGGCAGCGGCAACACCGACGCCCAAGGCAACCAGCAAGCCGGCAGCAC
CCTGCAAGCCAGTGCCAATGCCCCCGCCTTCTTCGCGGGCAAGGAAGCCGAAGCCCACACCCACAACGCC
AGCCTCTCCGGCCTCAAAAGCCAGCAACTCAATGCCAGCAAAACCGGGCAGGGCGGCTACAACCAACTCG
TCTTCGACGACACCCCCGGCGAATCCCGCATCGAAGTCTCTACCACCGAATACCAGAGCATTCTCCAACT
CGGCCACCTCAAACAACAAAGTGACAACGCCCGCCAAGCCGACCGTGGCCACGGCGCCGAACTGGCGACC
CAGTCTGCCAGCGCCATACGCGCCGGCAACGGCCTCCTGATCAGTGCCGATGCCCGCCCCAATGCCAGCA
GCAGCCACCTCGACAGCCGCGAACCCATCGCCCAGACCCAGGACGCCCAAAGCCTGACGCAAAGCTTGGC
GGAGGTCGCCGCCAAACAAAACGCCGCCCTCAAAGGCGACCCCCAAGCCGACAAACTCCCGGCCAGCGAA
GCCCTCAAACACGCCATCGACGTCATGAGCGCCACCGCGACTCAAGGCCAAACTCAAGCCGGCAGCGACA
CCATCAAAGCCACCCTCGGCGGCACCGGTACCGTCCCCGCCTGGTCAGAACCGCGCATTCAATACAGCGC
CCCGGCCGGCATCGCCCAACTCACCCCGCAAAACCACATCCTCGCCGCCGGCAAACACCTCAGCATTGCC
ACCGGACAGGACACCAACCTCATCGCCCAAGGCCACCACAGCCTCTCCGTCAAGGATGGCATTGCCCTCT
TCACCGTCGGCAAAGCCAAGGGCAAAAACAAACCCAACACTGAAACTGGCATCCACCTCCACGCCGCCAG
CGGAAGCGTCAGCCTGCAAAGCCAAAGCGGCAAAACCACCGGTGCTGCCGACAAGAAAGTGACGATCGCC
AGCACCACCGGTAACCTCAACGCCAGTGCCAAACAACACATCCTCGCTATGGCCCAAGGGGCTTACCTGA
AGATCGAGGGCGGGAATATTAGCCTGCATGCACCGGGCAAGGTGGAACTGAAGGCGAGTCAAAAGAATTT
GACGGGGCCCAAGAGTGCTTCAACAAACTTGCCGGCCTGGAACGTTGGCGAACTGAACTTGGCCAATTCT
CCTGAGCGAAAAGCAACCTGCCTCCAGGCGGCAAGCCGTAGCGGCGCTGCATTCGTTCAACTGGATAAGT
AA

Protein ID: 71907804
SecReT6 ID87
T6SS typei4b
Gene symbol-
Locus tagDaro_2182
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T6SS(s) in this replicon]
Location [Strand]2355510..2358245 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ47E10
KEGG IDdar:Daro_2182
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.50E-68, Aligned region: 36..348
DUF2345 [PF10106], Evalue: 1.50E-47, Aligned region: 593..622
DUF2345 [PF10106], Evalue: 1.50E-47, Aligned region: 679..832
T6SS_Vgr [PF13296], Evalue: 4.00E-36, Aligned region: 529..634
Phage_base_V [PF04717], Evalue: 1.50E-16, Aligned region: 391..506
Protein Sequence: 911 a.a.     [Download]
>gi|71907804|ref|YP_285391.1| Rhs element Vgr protein [Dechloromonas aromatica RCB]
MTQLLLDPLFNQHARLLELKTALPDAALIVERFNGREAISESFRFEIDCVSTNAYFDLKPLIGEEITLRL
LQADGSKRSWHGYVTQAMQLGADGGLARYRLIMEPFLAFLAQRRDCYLFQDKTVIDIIGQILADYPEAHW
SNQVTQSLRSHSVATQYRETDFEFIHRLLSEEGLSFRFEHDQSAAAGDDATHARHQLIVFDRETELPDGV
QPTIRFHRNNATEASDTLQQWHEIRTALPNAVSLAGWDYKTLVATGAQAQSSHDNGALPRLEIHDASRPY
RFEDSAAAQLRTDLALAAIEANYRRFAGESSVRQLAEGTVITLTQHEAYVSDESRFKVLSVDHHGANNLG
ASAAELLGSTEVEAGSYRNTLNAQPASIPVVSALLAKPAAHPQTALVVGLSDQVITTERDHRIKIQFHWQ
RGEAPNTGGISATGPNGRSAGKTGNAPGNDQSGTWVRVAEWLSGPNWGSHFLPRIGNEVLVDFLDGDIDR
PVIVGQSYNGADLPPFSAGHEANANHPGVLSGWMSHNHEEGHNQWVVDDAPGQLRTRLATSENAGQLGLG
HLVHQAPESASRGAWRGSGFELRTDGWLAVRAGEGILISATARPNAQSTQMDVAETVAQLKVAEETAKAL
SDAASQQQALPLKANAAQTKFIEGIDPKQQGKFSGSVGGQAAQKAQPGSRELGDPTERYAEPFILAEAPG
DIGLASPASTLLFAGANLHVTAQQDMHIASAYTVSTAVGQGASWFSHAGGIKSFAQAGTHTIQANTDQLE
ILADQSLTVTSTNDEIHILAKDKIVLQAGQSSVTLEGGNITFACPGNFSVKGSGNAFMGPGSDPAQVEGL
PDSRAKVFDEQIRALHSETGQPIAEMPYKMVTGDGEVFYGFTDQEGKTMRIGSAEPSTVKVYWGEMPPSE
T
 
Nucleotide Sequence: 2736 bp     [Download]
>gi|71905642|ref|NC_007298.1|:2355510-2358245 Dechloromonas aromatica RCB, complete genome
ATGACTCAGCTCCTCCTCGACCCCCTGTTCAACCAGCACGCCCGCCTGCTCGAACTCAAGACTGCCCTGC
CTGACGCTGCCTTGATTGTCGAACGCTTCAATGGTCGCGAAGCCATCTCTGAATCCTTCCGCTTCGAAAT
CGACTGCGTCTCAACCAACGCCTACTTCGACCTCAAGCCACTGATCGGCGAAGAGATCACCCTGCGCCTT
TTGCAGGCCGACGGCAGCAAGCGCTCCTGGCACGGCTACGTGACGCAAGCCATGCAACTCGGTGCCGATG
GCGGGCTGGCCCGCTACCGCCTGATCATGGAGCCCTTCCTCGCCTTCCTGGCCCAGCGTCGGGACTGCTA
CCTGTTTCAGGACAAAACGGTCATCGATATCATTGGCCAGATTCTGGCCGACTACCCGGAAGCCCATTGG
TCAAATCAGGTGACCCAGTCGCTACGCTCCCATAGCGTGGCAACCCAGTATCGGGAAACGGATTTCGAGT
TCATCCATCGCCTGCTCTCCGAAGAAGGCCTCTCCTTCCGTTTCGAACACGACCAATCCGCCGCAGCCGG
TGACGATGCCACCCACGCCCGCCACCAGTTGATCGTCTTCGACCGGGAGACCGAGCTGCCCGATGGGGTA
CAACCGACCATCCGTTTCCACCGCAACAACGCAACGGAGGCGTCGGACACTCTGCAACAGTGGCATGAAA
TCCGCACTGCCCTGCCCAACGCCGTGTCGCTGGCCGGCTGGGACTACAAGACCTTGGTCGCGACCGGTGC
CCAGGCTCAGAGCAGCCATGACAACGGCGCCTTGCCCCGGCTGGAAATCCACGACGCCTCCCGCCCTTAC
CGCTTTGAAGACAGCGCTGCCGCCCAGTTGCGCACCGACCTGGCGCTCGCCGCCATCGAAGCAAACTATC
GCCGCTTTGCCGGTGAAAGCAGCGTTCGTCAATTAGCCGAAGGAACCGTCATCACGCTGACCCAGCATGA
GGCCTATGTCAGTGACGAGTCGCGTTTCAAGGTGTTGTCCGTTGATCATCACGGAGCCAACAATCTAGGC
GCCAGTGCTGCCGAGCTGTTGGGCAGCACCGAGGTCGAGGCCGGTAGTTATCGCAATACGCTAAATGCGC
AGCCAGCGTCGATCCCGGTCGTCTCCGCGCTGCTGGCCAAACCGGCGGCCCACCCGCAGACCGCGCTGGT
GGTTGGCTTATCCGATCAGGTCATCACCACCGAGCGCGATCACCGGATAAAGATCCAGTTTCACTGGCAG
CGCGGTGAAGCACCCAACACCGGCGGTATCTCCGCAACCGGCCCGAACGGGCGAAGCGCCGGCAAGACCG
GCAATGCACCGGGCAACGACCAATCCGGCACTTGGGTGCGCGTCGCCGAATGGCTGTCGGGTCCGAACTG
GGGGAGCCATTTCCTGCCCCGGATCGGTAACGAGGTTCTGGTCGATTTCCTCGACGGTGATATCGACCGA
CCAGTGATTGTTGGCCAGAGCTATAACGGAGCGGACCTGCCGCCCTTCTCGGCTGGCCACGAGGCGAATG
CCAATCACCCCGGTGTACTGTCAGGCTGGATGAGCCACAACCACGAGGAAGGCCATAACCAGTGGGTGGT
CGATGATGCACCGGGGCAACTGCGCACCCGTCTGGCCACCAGCGAGAATGCCGGCCAGCTCGGATTGGGA
CATCTGGTGCACCAAGCCCCGGAAAGCGCCAGCCGAGGTGCTTGGCGCGGCAGCGGCTTTGAACTGAGAA
CCGATGGCTGGCTAGCGGTGCGAGCCGGCGAAGGCATCCTGATTTCAGCCACAGCTCGCCCGAATGCCCA
AAGTACCCAAATGGATGTGGCCGAAACCGTGGCGCAGTTGAAGGTAGCTGAAGAAACGGCCAAGGCCTTG
TCCGATGCGGCGAGCCAGCAACAGGCCTTGCCGCTGAAGGCGAATGCGGCGCAAACGAAATTTATCGAAG
GCATCGATCCCAAGCAACAAGGCAAATTCTCCGGCAGTGTCGGTGGGCAGGCGGCCCAGAAGGCGCAACC
GGGGAGCCGCGAACTGGGCGATCCGACTGAGCGTTATGCTGAACCGTTCATCCTGGCCGAAGCACCGGGC
GATATCGGCCTGGCCAGCCCGGCCAGTACCCTGCTCTTCGCTGGGGCCAATCTGCATGTGACGGCACAGC
AGGATATGCATATCGCCAGTGCGTATACGGTGTCGACGGCAGTAGGACAAGGCGCCAGCTGGTTCAGTCA
CGCCGGCGGGATCAAGAGCTTTGCCCAGGCTGGAACACACACCATTCAGGCGAATACCGATCAGCTGGAA
ATCCTCGCCGATCAATCCCTGACCGTGACCAGCACCAATGACGAGATTCACATCCTGGCCAAGGACAAGA
TCGTCCTGCAAGCCGGGCAGTCTTCCGTGACGCTGGAGGGGGGCAATATCACCTTCGCTTGTCCGGGGAA
TTTCTCGGTCAAGGGGAGTGGGAATGCGTTTATGGGGCCGGGGAGTGACCCGGCCCAGGTGGAGGGGTTG
CCGGATTCACGGGCGAAGGTGTTCGATGAACAAATTCGTGCGCTGCATTCTGAAACTGGGCAGCCTATTG
CCGAGATGCCATACAAAATGGTGACAGGAGATGGCGAGGTCTTCTATGGATTTACTGACCAAGAAGGAAA
AACCATGCGCATCGGATCTGCCGAGCCGAGCACAGTAAAAGTATATTGGGGTGAAATGCCACCCAGCGAG
ACATGA