SecReT6
Protein ID: 71907793
SecReT6 ID87
T6SS typei4b
Gene symbol-
Locus tagDaro_2171
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T6SS(s) in this replicon]
Location [Strand]2343212..2345911 [-]
ProductATPase AAA
NoteTssH
UniProt IDQ47E21
KEGG IDdar:Daro_2171
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.80E-43, Aligned region: 233..253
AAA_2 [PF07724], Evalue: 1.80E-43, Aligned region: 536..559
AAA_2 [PF07724], Evalue: 1.80E-43, Aligned region: 628..797
AAA [PF00004], Evalue: 6.60E-19, Aligned region: 233..338
AAA [PF00004], Evalue: 6.60E-19, Aligned region: 634..718
AAA_5 [PF07728], Evalue: 1.50E-13, Aligned region: 233..255
AAA_5 [PF07728], Evalue: 1.50E-13, Aligned region: 633..753
AAA_16 [PF13191], Evalue: 1.60E-12, Aligned region: 210..256
AAA_16 [PF13191], Evalue: 1.60E-12, Aligned region: 277..311
AAA_16 [PF13191], Evalue: 1.60E-12, Aligned region: 444..453
AAA_16 [PF13191], Evalue: 1.60E-12, Aligned region: 624..670
AAA_16 [PF13191], Evalue: 1.60E-12, Aligned region: 699..722
ClpB_D2-small [PF10431], Evalue: 2.90E-12, Aligned region: 804..877
Clp_N [PF02861], Evalue: 1.30E-08, Aligned region: 23..74
Clp_N [PF02861], Evalue: 1.30E-08, Aligned region: 113..124
Clp_N [PF02861], Evalue: 1.30E-08, Aligned region: 399..412
AAA_22 [PF13401], Evalue: 1.00E-07, Aligned region: 179..201
AAA_22 [PF13401], Evalue: 1.00E-07, Aligned region: 232..320
AAA_22 [PF13401], Evalue: 1.00E-07, Aligned region: 420..449
AAA_22 [PF13401], Evalue: 1.00E-07, Aligned region: 630..654
AAA_22 [PF13401], Evalue: 1.00E-07, Aligned region: 695..727
Sigma54_activat [PF00158], Evalue: 4.50E-06, Aligned region: 212..313
Sigma54_activat [PF00158], Evalue: 4.50E-06, Aligned region: 606..751
AAA_17 [PF13207], Evalue: 5.10E-06, Aligned region: 233..303
AAA_17 [PF13207], Evalue: 5.10E-06, Aligned region: 473..508
AAA_17 [PF13207], Evalue: 5.10E-06, Aligned region: 633..670
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 229..256
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 289..329
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 617..651
AAA_29 [PF13555], Evalue: 7.80E-05, Aligned region: 177..199
AAA_29 [PF13555], Evalue: 7.80E-05, Aligned region: 225..249
AAA_29 [PF13555], Evalue: 7.80E-05, Aligned region: 629..658
IstB_IS21 [PF01695], Evalue: 9.50E-05, Aligned region: 220..256
IstB_IS21 [PF01695], Evalue: 9.50E-05, Aligned region: 633..651
Arch_ATPase [PF01637], Evalue: 9.70E-05, Aligned region: 212..247
Arch_ATPase [PF01637], Evalue: 9.70E-05, Aligned region: 285..317
Arch_ATPase [PF01637], Evalue: 9.70E-05, Aligned region: 631..670
Arch_ATPase [PF01637], Evalue: 9.70E-05, Aligned region: 704..727
AAA_19 [PF13245], Evalue: 0.00021, Aligned region: 233..258
AAA_19 [PF13245], Evalue: 0.00021, Aligned region: 631..655
Zeta_toxin [PF06414], Evalue: 0.00055, Aligned region: 178..199
Zeta_toxin [PF06414], Evalue: 0.00055, Aligned region: 233..254
Zeta_toxin [PF06414], Evalue: 0.00055, Aligned region: 620..673
NACHT [PF05729], Evalue: 0.00087, Aligned region: 233..260
NACHT [PF05729], Evalue: 0.00087, Aligned region: 634..655
RNA_helicase [PF00910], Evalue: 0.0012, Aligned region: 179..213
RNA_helicase [PF00910], Evalue: 0.0012, Aligned region: 234..255
RNA_helicase [PF00910], Evalue: 0.0012, Aligned region: 634..655
SRP54 [PF00448], Evalue: 0.0019, Aligned region: 233..256
SRP54 [PF00448], Evalue: 0.0019, Aligned region: 632..665
AAA_18 [PF13238], Evalue: 0.0022, Aligned region: 233..253
AAA_18 [PF13238], Evalue: 0.0022, Aligned region: 635..663
MobB [PF03205], Evalue: 0.0023, Aligned region: 234..258
MobB [PF03205], Evalue: 0.0023, Aligned region: 451..490
MobB [PF03205], Evalue: 0.0023, Aligned region: 632..665
ResIII [PF04851], Evalue: 0.005, Aligned region: 217..254
ResIII [PF04851], Evalue: 0.005, Aligned region: 301..314
ResIII [PF04851], Evalue: 0.005, Aligned region: 605..654
AAA_23 [PF13476], Evalue: 0.0068, Aligned region: 233..249
AAA_23 [PF13476], Evalue: 0.0068, Aligned region: 458..487
AAA_23 [PF13476], Evalue: 0.0068, Aligned region: 630..667
DUF258 [PF03193], Evalue: 0.0087, Aligned region: 224..251
DUF258 [PF03193], Evalue: 0.0087, Aligned region: 631..645
Protein Sequence: 899 a.a.     [Download]
>gi|71907793|ref|YP_285380.1| ATPase AAA [Dechloromonas aromatica RCB]
MSTSLKTLISKLNSTCRQAAERAASLCMSRGNYEVDLEHLLIAILENPGADLLVIGKRCGISPTGLEREL
NQEIDRFKTGNTRTPVFSTHILKLFEQAWLIASLDARLPRIRSGHLLLALLTEPELSQLAFRGSKLLGKV
RLDELKHNFDQMTEGSAEAAEVAGLAASAEGGDESDPLLAGSPQGGKTPALDQFTTNLTQRARDGKVDPV
IGRDSEIRQVIDILMRRRQNNPILTGEAGVGKTAVVEGLALRIAQDDVPPPLLGVELHTLDMGLLQAGAS
VKGEFENRLKNVIDEVKKSVKPIILFIDEAHTMIGAGGQSGQNDAANLLKPALARGELRTVAATTWAEYK
KYFEKDAALARRFQGVKVEEPTEILASAMLRGMVPLMEKHFGIRVLDEAVTEAVRLSHRYISGRQLPDKA
ISVLDTACAKVALGQSATPALIDEADKRLLRERAELAALEREAASGAWHDTRIKELKAQISAIESDLSIF
KTRFEEEKTLVNRVLELRGQLENGEVAVDAAPKPKARARKKGEGEAVGDSELDKALARLRELQGESPMVP
LQVDGHVVAEIIAAWTGIPLGKMVKNEINTVLNLKPLLKERVIGQDHALEAVAQRVRTARAYLEDPNKPK
GVFMFVGPSGVGKTETALALADILYGGERKLVTINMSEYQEAHSVSGLKGSPPGYVGYGEGGVLTEAVRR
NPYSVVLLDEVEKAHPDVLELFFQVFDKGVLDDAEGREIDFRNTLIILTSNVGSTQIMQSCLNKPAEELP
EADALADALRPILFKSFKPAFLGRMKVVPYYPISDDVLVSIIELKLGRIRDRIAANHKAEFIWDDKLVEA
VLARCTEVDSGARNVDHILNGTLLPEIAEVVLARMAEGAAVERIKVGAGKSGEFKYAIK
 
Nucleotide Sequence: 2700 bp     [Download]
>gi|71905642|ref|NC_007298.1|:c2345911-2343212 Dechloromonas aromatica RCB, complete genome
ATGAGCACCTCCCTGAAAACCCTGATCAGCAAACTGAATAGCACCTGCCGCCAGGCAGCCGAACGCGCCG
CCAGTCTGTGCATGTCGCGCGGCAATTACGAGGTTGATCTTGAGCACCTGTTGATCGCGATTCTCGAAAA
TCCCGGGGCAGACCTGCTGGTCATCGGCAAGCGTTGCGGTATCAGCCCGACCGGCCTGGAGCGCGAACTG
AACCAGGAAATCGACCGCTTCAAGACCGGCAATACCCGGACGCCGGTTTTCTCGACGCACATTCTCAAGC
TCTTCGAACAAGCCTGGCTGATCGCCTCGCTCGATGCCCGCCTGCCGCGCATTCGTTCCGGCCACCTGTT
GCTGGCGCTGCTGACCGAGCCGGAGCTGTCGCAACTGGCTTTCCGTGGTTCCAAACTGCTGGGCAAGGTT
CGTTTGGACGAACTGAAGCACAACTTCGACCAGATGACCGAAGGCTCGGCCGAAGCGGCCGAAGTAGCCG
GCCTGGCAGCGTCGGCTGAGGGCGGAGATGAATCCGACCCCTTGCTCGCCGGTAGCCCGCAAGGTGGCAA
GACACCGGCGCTTGACCAATTCACCACCAACCTGACGCAACGGGCTCGCGATGGCAAGGTTGATCCGGTG
ATCGGCCGTGACAGCGAAATTCGTCAGGTGATCGACATCCTGATGCGGCGCCGCCAGAACAATCCGATCC
TGACCGGTGAGGCCGGTGTCGGCAAGACCGCCGTTGTCGAAGGGTTGGCCTTGCGCATCGCCCAGGACGA
TGTGCCGCCACCGCTGCTCGGAGTCGAACTGCACACGCTGGACATGGGGCTGCTGCAGGCCGGCGCCAGC
GTCAAGGGCGAGTTCGAGAACCGCCTGAAAAACGTCATCGATGAGGTCAAGAAGAGCGTCAAGCCGATCA
TCCTGTTCATCGACGAAGCCCACACCATGATCGGGGCAGGGGGGCAGTCCGGCCAGAACGACGCGGCCAA
CCTGCTCAAGCCGGCGCTGGCACGCGGCGAGTTGCGCACCGTGGCGGCAACGACCTGGGCCGAGTACAAG
AAATACTTCGAGAAGGATGCCGCGCTGGCTCGCCGCTTCCAGGGCGTCAAAGTCGAGGAGCCAACCGAGA
TACTGGCCTCTGCCATGTTGCGCGGCATGGTGCCGTTGATGGAAAAGCATTTCGGTATTCGCGTTCTCGA
CGAAGCCGTGACCGAAGCGGTTCGCCTGTCGCACCGCTACATCAGCGGCCGCCAACTGCCGGACAAGGCA
ATCAGCGTGCTCGACACGGCTTGTGCCAAGGTGGCGCTTGGCCAGAGTGCCACGCCAGCCTTGATAGACG
AAGCTGACAAGCGGCTGCTGCGCGAGCGGGCCGAACTGGCCGCCCTTGAACGCGAAGCCGCCAGCGGCGC
CTGGCACGATACGCGGATCAAGGAACTCAAGGCGCAGATTTCCGCCATCGAATCTGATCTCAGCATCTTC
AAGACGCGTTTTGAAGAAGAAAAAACCTTGGTCAATCGCGTTCTCGAACTGCGTGGACAGCTCGAAAATG
GCGAGGTGGCCGTCGACGCCGCACCAAAACCCAAAGCCAGGGCGCGCAAGAAAGGCGAGGGCGAAGCGGT
CGGTGATAGCGAACTCGACAAGGCCCTGGCGCGTCTGCGCGAGTTGCAGGGCGAGTCGCCGATGGTTCCG
CTGCAGGTCGATGGTCACGTCGTCGCCGAGATCATTGCCGCCTGGACCGGTATTCCGCTCGGCAAAATGG
TCAAGAACGAGATCAACACTGTCCTCAACCTGAAGCCGCTCCTAAAGGAACGGGTCATCGGCCAGGATCA
TGCGCTGGAGGCTGTGGCCCAGCGCGTTCGCACCGCCCGCGCCTACCTCGAAGACCCGAACAAGCCGAAA
GGCGTCTTCATGTTTGTCGGCCCCTCCGGTGTCGGCAAGACCGAAACCGCCCTGGCGCTGGCCGATATCC
TCTACGGCGGCGAACGCAAGCTGGTTACCATCAATATGAGCGAATACCAGGAAGCTCACTCGGTGTCCGG
TCTCAAGGGCTCGCCACCGGGCTACGTTGGCTACGGCGAAGGCGGGGTGCTGACCGAAGCCGTGCGGCGC
AATCCCTATAGCGTTGTCCTGCTCGATGAAGTGGAGAAGGCTCACCCGGACGTGCTGGAACTCTTCTTCC
AGGTCTTCGACAAGGGCGTCCTCGACGATGCCGAAGGCCGTGAAATCGATTTCCGCAACACCCTGATCAT
CCTGACCAGCAATGTCGGTTCGACGCAGATCATGCAGTCCTGTCTGAACAAGCCGGCCGAAGAACTGCCG
GAAGCCGATGCGCTGGCCGATGCCCTGCGCCCGATCCTGTTCAAGTCCTTCAAGCCGGCCTTCCTTGGCC
GTATGAAGGTGGTTCCTTACTACCCGATCTCCGACGACGTGCTGGTCAGCATCATCGAACTCAAGCTCGG
CCGCATCCGTGACCGGATTGCCGCCAACCACAAGGCTGAGTTCATCTGGGACGACAAGCTGGTCGAAGCC
GTGCTGGCTCGCTGCACAGAGGTCGATTCCGGGGCGCGCAACGTCGATCACATCCTCAACGGCACCCTGT
TGCCCGAGATCGCCGAGGTGGTATTGGCCCGCATGGCTGAAGGCGCTGCGGTCGAGCGCATCAAGGTAGG
GGCCGGCAAGAGCGGTGAATTCAAATACGCCATCAAGTAA