SecReT6
Protein ID: 71907794
SecReT6 ID87
T6SS typei4b
Gene symbol-
Locus tagDaro_2172
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T6SS(s) in this replicon]
Location [Strand]2345929..2346993 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ47E20
KEGG IDdar:Daro_2172
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.90E-93, Aligned region: 18..334
Protein Sequence: 354 a.a.     [Download]
>gi|71907794|ref|YP_285381.1| hypothetical protein Daro_2172 [Dechloromonas aromatica RCB]
MRTSQRRLDPGLVDSTLEAPERYEFFQLVRLYESVFRKTARTAGGDVVNERIRFRNSLRLGFAPSQVDAM
APSYRIDEEGLATADLERVEITPSFMGMLGVNGTLPIHYTEQVINQARFKRDDSGRAFLDLFTNRSVGHF
YRAWKKYKLPIQYETDRQNRFLPIILALSGLGFDALRQRMNEGPGAIDDESIAFFAGLLRQRPVSAETLQ
RVISGYFRESVEVEQFVGHWYAIPAEQRSTLGGHNVVLGGNALVGERVWQRNLRLRIHIGPLRHERYLAF
LPNGELAAALKKILTLATGGQFEYEICPILRAADVRPAGLGAANGCRLGYDSFMLTSPETNDRSDTRYLT
NFIH
 
Nucleotide Sequence: 1065 bp     [Download]
>gi|71905642|ref|NC_007298.1|:c2346993-2345929 Dechloromonas aromatica RCB, complete genome
ATGCGCACCTCGCAACGGCGACTCGATCCTGGCCTAGTCGATAGCACCCTTGAGGCGCCGGAACGCTACG
AGTTTTTCCAGCTCGTGCGTCTGTATGAAAGCGTCTTCCGGAAAACGGCCCGGACAGCCGGTGGCGATGT
CGTCAACGAGCGGATTCGCTTCCGTAATTCGTTGCGTCTCGGCTTTGCACCCAGCCAGGTCGACGCCATG
GCACCGAGTTACCGGATCGATGAAGAAGGGCTGGCTACCGCCGATCTGGAGCGGGTCGAGATCACGCCAA
GTTTCATGGGTATGCTGGGCGTCAATGGCACGCTGCCGATTCATTACACCGAGCAGGTCATCAACCAGGC
GCGCTTCAAGCGTGATGACTCCGGGCGGGCATTCCTCGATCTGTTCACCAATCGCTCGGTTGGTCATTTC
TACCGCGCCTGGAAGAAATACAAGCTGCCGATCCAGTATGAAACGGATCGGCAGAACCGTTTTCTCCCGA
TTATTCTGGCGCTGAGCGGACTGGGCTTTGATGCCTTGCGTCAACGCATGAATGAAGGACCAGGCGCCAT
CGACGATGAGTCGATTGCCTTCTTTGCCGGCCTTTTGCGGCAGCGGCCGGTCTCGGCCGAAACCCTGCAG
CGCGTGATCAGCGGCTATTTTCGCGAAAGCGTCGAAGTTGAACAGTTCGTCGGGCATTGGTATGCCATTC
CTGCTGAGCAGCGCTCGACGCTGGGTGGCCACAACGTCGTACTGGGCGGCAACGCCCTGGTTGGCGAACG
GGTCTGGCAGCGTAATTTGCGACTGCGCATCCATATTGGCCCCCTGCGTCACGAGCGCTACCTGGCCTTC
CTGCCTAATGGCGAGCTGGCTGCCGCCCTCAAGAAAATCCTTACGCTGGCGACGGGCGGCCAGTTCGAAT
ACGAAATCTGCCCGATCCTGCGCGCTGCCGATGTGCGCCCGGCCGGCCTGGGCGCTGCGAACGGCTGCCG
CCTGGGTTACGACAGCTTCATGCTGACTAGTCCGGAAACAAACGACCGCAGCGATACCCGCTATCTCACC
AATTTCATTCACTAA