SecReT6
Protein ID: 71907795
SecReT6 ID87
T6SS typei4b
Gene symbol-
Locus tagDaro_2173
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T6SS(s) in this replicon]
Location [Strand]2346957..2348789 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ47E19
KEGG IDdar:Daro_2173
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 8.40E-198, Aligned region: 4..609
Protein Sequence: 610 a.a.     [Download]
>gi|71907795|ref|YP_285382.1| hypothetical protein Daro_2173 [Dechloromonas aromatica RCB]
MEDLLPYYERELAFLRQHSREFAERYPKLSAQLLLSGEGCDDPHVERMIQSFALLTARVSKKLEDSYPQF
TEALLNVLYPHYLRPFPSCSIAHFEHGGGELTSVATILRGTELQSRPIKGAVCKFRTAWDVQLAPVSIGE
LAFDPVASAPSEVRLPVGCNAILSFSLTLRGNNPEAGLGKLEKLRVYIDAEPSVASALRDAIFLRKLKVY
AVGADERWRIAREKLISEVGFADQEALIDMPDTSHGAYRYLTEYFCFPEKFNFFDINIGEIPSGLHAEGK
ISLHIALGDLRADSDASRLLQTLTTQNLRLGCVPVVNLFAQRGDPIRISNRQTAYPVVADGRRAYAYDVY
SIDSVRRVRQSAQGEAITEFRSFFSLRHGETPERNGYYWYAQRDHLVAESSPGYETSLSIVDADFDPVQP
KTDVLSLQLTCTNRELPTLMSVGMPSGDLFLEGGSSVRSIKLLRKPTQPYRFDHRRDGQWRIISHLSLNH
LSLTGNGLKAFQEMLALYDLPRTAASRRQIEGVLDIEQRDKTVWMAGKPFACFVRGQEVRITIDESSFVG
SGLDVFVRCIDRFLGLYVSLNSFIQLVVVSNRTGEELIRCAPRNGDSILA
 
Nucleotide Sequence: 1833 bp     [Download]
>gi|71905642|ref|NC_007298.1|:c2348789-2346957 Dechloromonas aromatica RCB, complete genome
GTGGAAGATCTGCTGCCTTATTACGAGCGAGAGCTGGCGTTTTTGCGCCAGCATTCCCGCGAGTTCGCCG
AGCGCTACCCGAAGCTTTCTGCACAGTTGTTGCTGTCGGGCGAGGGCTGCGACGACCCGCATGTCGAGCG
GATGATCCAGTCCTTCGCGTTGCTGACGGCGCGGGTTTCCAAAAAGCTGGAAGACAGCTACCCGCAATTC
ACTGAAGCACTGCTCAACGTCCTCTACCCGCACTATCTGCGGCCGTTTCCGAGTTGCTCCATCGCTCATT
TCGAACATGGCGGCGGTGAGCTGACCTCAGTTGCGACCATCTTGCGGGGAACAGAGTTGCAATCCCGACC
GATCAAGGGTGCCGTCTGCAAGTTCCGGACGGCATGGGATGTTCAACTGGCGCCGGTTTCCATTGGCGAG
CTGGCATTCGATCCGGTGGCCAGTGCGCCCAGCGAAGTACGTCTGCCGGTCGGTTGTAATGCCATTCTTT
CGTTTTCGCTTACCTTGCGTGGCAACAACCCCGAGGCCGGGCTGGGCAAGCTCGAGAAGTTGCGGGTCTA
TATCGATGCCGAGCCGTCGGTCGCTTCGGCGCTGCGCGACGCCATTTTCCTGCGCAAATTGAAAGTTTAT
GCCGTCGGTGCAGACGAGCGCTGGCGTATCGCGCGGGAGAAGCTGATCAGCGAGGTCGGCTTTGCCGATC
AGGAGGCGCTGATCGACATGCCGGACACGTCACACGGCGCCTATCGCTACCTGACCGAGTATTTCTGTTT
CCCGGAGAAATTCAATTTTTTTGATATCAACATCGGCGAGATTCCTTCCGGCTTGCACGCCGAAGGGAAG
ATATCCCTTCACATCGCGCTCGGTGATCTGCGGGCGGACAGTGATGCCTCCCGTTTGCTGCAAACGCTAA
CCACGCAGAACCTGCGCTTGGGTTGTGTGCCGGTAGTCAATCTGTTTGCCCAGCGGGGTGATCCGATCCG
GATCAGCAATCGCCAGACGGCCTATCCGGTGGTTGCCGACGGGCGACGGGCTTACGCCTACGATGTTTAT
TCGATTGACTCGGTCCGACGAGTCCGCCAAAGCGCGCAGGGCGAAGCGATTACCGAGTTTCGCTCCTTCT
TTTCGCTGCGCCATGGCGAAACCCCGGAGCGCAACGGCTATTACTGGTATGCCCAGCGTGATCACCTGGT
TGCAGAAAGCAGCCCGGGTTACGAAACCTCGCTGTCCATCGTCGATGCCGATTTCGACCCGGTGCAGCCG
AAGACCGACGTGCTCAGCCTGCAGCTGACCTGCACCAATCGCGAATTGCCGACCTTAATGTCAGTCGGCA
TGCCGTCCGGCGACCTGTTTCTCGAAGGCGGCTCGAGCGTTCGTTCGATCAAGCTGCTGCGTAAACCGAC
TCAGCCCTATCGTTTCGATCATCGACGGGATGGTCAGTGGCGGATCATTTCGCATCTGTCGCTGAATCAT
CTGTCGCTGACCGGCAATGGTCTCAAGGCATTCCAGGAGATGCTGGCGCTCTACGATCTGCCGAGAACGG
CGGCCAGCCGCCGGCAGATCGAAGGCGTGCTCGATATCGAGCAGCGAGACAAAACGGTGTGGATGGCCGG
AAAACCGTTTGCCTGCTTTGTGCGAGGCCAGGAGGTTCGCATCACCATTGACGAATCCAGCTTCGTCGGC
AGCGGTCTTGATGTGTTCGTTCGCTGCATCGACCGCTTCCTCGGCCTGTACGTCAGTCTCAACAGCTTCA
TTCAACTGGTTGTGGTTTCCAATCGAACCGGAGAGGAATTGATCCGATGCGCACCTCGCAACGGCGACTC
GATCCTGGCCTAG