SecReT6
Protein ID: 71907796
SecReT6 ID87
T6SS typei4b
Gene symbol-
Locus tagDaro_2174
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T6SS(s) in this replicon]
Location [Strand]2348790..2349269 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ47E18
KEGG IDdar:Daro_2174
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.00E-22, Aligned region: 27..135
Protein Sequence: 159 a.a.     [Download]
>gi|71907796|ref|YP_285383.1| hypothetical protein Daro_2174 [Dechloromonas aromatica RCB]
MIKGFEPSLFDKLFDDQPVGAARRRLSLEQLKDSVARDLEALLNTRVVLDDGFETTYPLTMRSVAGFGLS
DFAGLSLANVHDRRRICASIESAIAAHEPRLREVRVDLELHRKTVNALYFSINAVLVVRPAQEPVSFDAL
LQPTSLQYSVTRHRPRLGG
 
Nucleotide Sequence: 480 bp     [Download]
>gi|71905642|ref|NC_007298.1|:c2349269-2348790 Dechloromonas aromatica RCB, complete genome
ATGATCAAAGGTTTTGAGCCTTCCCTGTTCGATAAATTATTCGACGATCAGCCCGTTGGGGCTGCCCGGC
GTCGTCTGTCGCTTGAGCAGTTGAAGGACTCGGTCGCCCGTGATCTTGAAGCGCTGCTCAATACACGGGT
GGTGCTCGATGATGGGTTCGAGACAACCTACCCGCTGACGATGCGCTCGGTCGCCGGTTTTGGTTTGTCC
GACTTCGCCGGGCTCAGCCTGGCTAATGTCCATGACCGACGTCGAATCTGCGCTTCGATCGAATCGGCCA
TTGCGGCTCACGAGCCGCGCTTGCGTGAGGTTCGTGTCGATCTTGAATTGCATCGAAAGACGGTGAACGC
CCTGTATTTCTCAATCAATGCCGTGCTGGTCGTCAGGCCAGCCCAGGAACCGGTCAGTTTCGATGCACTG
CTGCAGCCGACCAGCCTGCAGTATTCCGTGACCCGGCACCGTCCGCGGCTGGGGGGCTAG