SecReT6
Protein ID: 71907797
SecReT6 ID87
T6SS typei4b
Gene symbol-
Locus tagDaro_2175
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T6SS(s) in this replicon]
Location [Strand]2349318..2349854 [-]
Producthypothetical protein
NoteTssD
UniProt IDQ47E17
KEGG IDdar:Daro_2175
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.60E-50, Aligned region: 5..150
Protein Sequence: 178 a.a.     [Download]
>gi|71907797|ref|YP_285384.1| hypothetical protein Daro_2175 [Dechloromonas aromatica RCB]
MKDIYVEFKGSDIKGDSRDAKHKDTVEVYSWSHTMRQPKSATASAAGGHTAERVEHGEMIFTKDIDGSSP
KLYQACSSGLVVSDVIIYFYRAFGGQNTTGNPSATQNRHQYLKIELKNVIIASVSPAVDEEGIPKESFSL
KYSAVKWTYDELNIDGTKSGKVNIQGAWNLAKNTPNLT
 
Nucleotide Sequence: 537 bp     [Download]
>gi|71905642|ref|NC_007298.1|:c2349854-2349318 Dechloromonas aromatica RCB, complete genome
ATGAAGGATATTTACGTCGAATTCAAGGGTAGTGACATCAAGGGCGATTCCCGCGATGCCAAGCACAAGG
ACACGGTTGAGGTTTACAGCTGGAGCCACACCATGCGCCAGCCGAAGTCGGCAACGGCATCGGCTGCTGG
CGGCCATACTGCCGAGCGCGTCGAACACGGCGAAATGATCTTTACCAAGGATATCGACGGTTCCAGCCCG
AAGCTGTATCAGGCTTGTTCGTCCGGCCTGGTGGTCAGCGATGTCATCATCTACTTCTACCGCGCTTTCG
GTGGTCAGAATACGACCGGCAATCCGTCGGCTACCCAGAATCGTCATCAGTACCTGAAGATCGAACTGAA
GAATGTCATCATCGCCTCGGTTTCCCCGGCTGTTGATGAGGAAGGCATTCCCAAGGAAAGTTTCTCGCTG
AAGTATTCCGCCGTGAAGTGGACCTACGACGAGCTGAACATCGACGGTACCAAGTCCGGCAAGGTCAATA
TCCAGGGCGCCTGGAACCTGGCCAAGAACACGCCGAATCTGACCTGA