SecReT6
Protein ID: 71907798
SecReT6 ID87
T6SS typei4b
Gene symbol-
Locus tagDaro_2176
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T6SS(s) in this replicon]
Location [Strand]2349887..2351371 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ47E16
KEGG IDdar:Daro_2176
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.80E-193, Aligned region: 66..489
Protein Sequence: 494 a.a.     [Download]
>gi|71907798|ref|YP_285385.1| hypothetical protein Daro_2176 [Dechloromonas aromatica RCB]
MSAQAAVASAPANARESGLLDQIIEESRVAQSDQEKNRARDIISELVNQVLDGEVVVSENLAASLDARVA
ELDRLISEQLSEVMHAPEFQALESAWTGLHYLCKQTSTGQQLKIKLFNASKRELVKDFKTAIDFDQSALF
KKVYEEEFGTFGGAPFGTLIGQYEISRQPEDMYFVEQMSHIAAASHAPFIASAAPQLFGLESHTELGKPR
DMGKVFDTVEYAKWKSFRESEDSRYVGLALPRFLGRLPYNPIDGEVTEGFNFVEEVDGTDHDKYLWCNAA
FAFAARLTDAFENYGWCAAIRGVEGGGLVEDLPTHTFRTDDGEVALKCPTEISITDRREKELSDLGFIPL
VHCKNTDYAAFFGAQSAQKARKYDTDSANANASLSAQLQYMFAVSRIAHYMKAMMRDKIGSFASAANVQN
YLQRWIDQYVTADDSASQETKAQFPLREASVEVSEVPGRPGVYRAVSFIRPHFQLDELSVSLRLVAELPQ
STKS
 
Nucleotide Sequence: 1485 bp     [Download]
>gi|71905642|ref|NC_007298.1|:c2351371-2349887 Dechloromonas aromatica RCB, complete genome
ATGAGCGCGCAGGCTGCAGTTGCCTCCGCGCCGGCCAATGCTCGCGAATCGGGCCTGCTCGACCAGATCA
TCGAAGAGAGCCGTGTCGCCCAGTCCGATCAGGAAAAGAACCGGGCCCGCGACATTATCAGCGAACTGGT
CAATCAGGTGCTGGATGGCGAAGTGGTTGTTTCCGAGAATCTGGCAGCATCCCTCGATGCCCGCGTGGCC
GAACTCGATCGCCTGATTTCCGAGCAGCTAAGTGAAGTGATGCATGCTCCTGAATTCCAAGCCCTCGAAA
GTGCCTGGACCGGTCTGCATTACCTTTGCAAGCAGACCTCGACTGGCCAGCAACTCAAGATCAAGCTGTT
CAACGCTTCGAAGCGCGAATTGGTCAAAGATTTCAAGACAGCCATCGATTTCGACCAGAGCGCCTTGTTC
AAGAAGGTTTATGAAGAAGAATTCGGCACTTTCGGTGGTGCGCCGTTTGGTACCTTGATCGGTCAGTACG
AAATCAGCCGTCAGCCCGAGGATATGTACTTCGTCGAACAGATGTCGCATATCGCCGCTGCCTCGCATGC
GCCGTTCATTGCTTCCGCCGCGCCGCAGTTGTTCGGCCTGGAGTCACATACCGAACTCGGCAAGCCGCGC
GACATGGGCAAGGTGTTCGATACCGTCGAATACGCCAAGTGGAAGTCCTTCCGTGAGTCCGAGGATTCGC
GCTATGTCGGTCTCGCCTTGCCACGCTTCCTCGGCCGATTGCCCTATAACCCGATTGATGGCGAAGTCAC
TGAGGGCTTCAATTTTGTTGAAGAGGTTGATGGTACTGATCACGACAAGTACCTCTGGTGCAATGCCGCC
TTTGCCTTTGCGGCCCGTCTGACCGATGCCTTCGAGAACTATGGCTGGTGTGCCGCGATTCGCGGCGTTG
AAGGTGGTGGCCTGGTTGAAGATCTGCCGACGCACACCTTCCGCACCGACGACGGTGAAGTAGCACTCAA
GTGCCCGACGGAAATTTCGATTACCGATCGTCGCGAAAAAGAGTTGAGCGATCTTGGCTTCATCCCGCTG
GTTCATTGCAAGAACACAGATTACGCGGCGTTCTTTGGCGCGCAATCAGCGCAGAAGGCAAGAAAGTACG
ATACCGACTCGGCCAATGCCAATGCTTCGCTGTCCGCCCAGTTGCAATACATGTTTGCTGTGTCCCGTAT
CGCTCATTACATGAAGGCGATGATGCGCGACAAGATCGGCAGCTTTGCTTCCGCGGCCAATGTGCAGAAC
TATCTGCAGCGATGGATTGATCAGTATGTAACCGCCGACGATTCCGCTTCCCAGGAAACCAAGGCGCAAT
TCCCGCTGCGCGAGGCTTCCGTGGAAGTCAGCGAAGTGCCGGGTCGCCCTGGTGTTTATCGGGCCGTGTC
GTTTATCCGGCCACATTTCCAGCTGGATGAGCTTTCGGTATCGCTGCGTCTGGTTGCCGAGTTGCCGCAA
TCGACCAAGAGCTAA