SecReT6
Protein ID: 71907799
SecReT6 ID87
T6SS typei4b
Gene symbol-
Locus tagDaro_2177
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T6SS(s) in this replicon]
Location [Strand]2351368..2351880 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ47E15
KEGG IDdar:Daro_2177
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.60E-57, Aligned region: 11..165
DASH_Spc34 [PF08657], Evalue: 0.00066, Aligned region: 48..160
Protein Sequence: 170 a.a.     [Download]
>gi|71907799|ref|YP_285386.1| hypothetical protein Daro_2177 [Dechloromonas aromatica RCB]
MAKKESVQKRLQKVRPPRVQLTYDVEIGDALEVKELPFVVGVLGDFAAQSKEPQGKVRDRKFVNVDMDNF
DDVMEGMAPRAAFRVKNRLTEAGGELGVDIKFEKFEDFRPESVVQQVEPLRKLQEARAKLADLRNKLAGN
EKLEDLLNDVLNSTEQLQSLGGKTNAGDGQ
 
Nucleotide Sequence: 513 bp     [Download]
>gi|71905642|ref|NC_007298.1|:c2351880-2351368 Dechloromonas aromatica RCB, complete genome
GTGGCGAAAAAAGAGAGTGTTCAAAAGCGGTTGCAAAAGGTTCGTCCGCCGCGCGTTCAGCTAACCTACG
ATGTTGAGATCGGCGATGCCCTCGAGGTCAAGGAGTTGCCCTTTGTGGTTGGCGTACTAGGGGATTTTGC
TGCCCAGTCAAAAGAGCCGCAGGGCAAGGTTCGCGATCGCAAGTTTGTGAACGTTGATATGGACAATTTC
GACGATGTCATGGAAGGCATGGCGCCGCGCGCTGCATTCCGCGTCAAGAACCGACTGACCGAAGCCGGTG
GCGAACTGGGCGTCGATATCAAGTTCGAAAAATTCGAGGATTTTCGCCCGGAGTCTGTGGTTCAGCAGGT
TGAACCGCTGCGCAAGCTGCAGGAAGCGCGGGCCAAGCTGGCCGATCTCCGTAACAAGCTGGCCGGCAAT
GAAAAGCTTGAAGATCTGCTGAATGATGTCCTGAACAGCACCGAGCAGTTGCAGAGTCTGGGCGGCAAGA
CGAACGCAGGAGACGGACAATGA