SecReT6
Protein ID: 71907801
SecReT6 ID87
T6SS typei4b
Gene symbol-
Locus tagDaro_2179
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T6SS(s) in this replicon]
Location [Strand]2352804..2353373 [+]
Productlipoprotein
NoteTssJ
UniProt IDQ47E13
KEGG IDdar:Daro_2179
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.90E-28, Aligned region: 2..162
Protein Sequence: 189 a.a.     [Download]
>gi|71907801|ref|YP_285388.1| lipoprotein [Dechloromonas aromatica RCB]
MLLSGCAQVSALQMAGTAVGMVLEATGVTKKDNGDQSKITKDLPIRIFAGDQLNLTSNSKPLSLVIKIYV
LRSSERLKTLTYPQITSTESEKEALGDELISVREIILLPGKSYDAVLKIPGDATTIGVVGMFRAPYSSRW
KLAFDSKQSFDSGITIGAHACALSASKGALVTEISPESVRSLVGIQCNS
 
Nucleotide Sequence: 570 bp     [Download]
>gi|71905642|ref|NC_007298.1|:2352804-2353373 Dechloromonas aromatica RCB, complete genome
ATGCTGCTTTCCGGCTGTGCTCAGGTTTCCGCCTTGCAGATGGCCGGAACCGCTGTGGGGATGGTTCTCG
AAGCGACGGGCGTCACCAAGAAAGACAATGGCGACCAAAGCAAAATCACCAAAGATCTGCCAATAAGGAT
TTTTGCCGGTGATCAGTTAAATTTGACTAGCAACAGCAAACCGCTGTCCCTGGTCATCAAGATTTACGTT
TTGCGTTCTTCTGAACGCCTTAAAACACTCACCTACCCGCAGATAACCTCCACCGAGAGCGAAAAGGAGG
CTCTTGGCGATGAGTTGATTTCAGTCCGTGAAATTATTCTGCTCCCCGGAAAATCCTACGACGCTGTTCT
AAAGATTCCCGGAGATGCCACAACGATCGGTGTCGTTGGCATGTTTCGCGCGCCGTATTCGTCCAGATGG
AAACTCGCTTTCGACAGCAAGCAGTCATTCGATAGCGGAATCACCATCGGGGCGCACGCCTGTGCCCTGA
GCGCCAGCAAAGGCGCCTTGGTCACCGAAATCAGCCCTGAATCAGTGCGATCACTGGTCGGCATCCAATG
CAACTCTTAA