SecReT6
Protein ID: 71907802
SecReT6 ID87
T6SS typei4b
Gene symbol-
Locus tagDaro_2180
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T6SS(s) in this replicon]
Location [Strand]2353386..2354729 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ47E12
KEGG IDdar:Daro_2180
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.10E-121, Aligned region: 18..445
Protein Sequence: 447 a.a.     [Download]
>gi|71907802|ref|YP_285389.1| hypothetical protein Daro_2180 [Dechloromonas aromatica RCB]
MNNAKILWGEGLFLRPQHFQQQDIQTDAMNRRTLLSANPFAWGMRDLDLDLDSLKNGVLRFNRIDAVFAN
GNFFTAPDIDQLPAPLALDAAVDEDGATEFFLALHHLNAHGGNCAEDVSDSGQARYLIVPRDRADLYTEA
AEADIATLSQISHLKSANENRDQFLTLPVARIRRTSSNGFEVDPSFVPPSISLRSAPNLYTLLRRQIDAL
LAKVDALYGFHREPSKNVIEFRSGDIASFWLLHTASSACATLTHLFRNPDTSPERLFQELLRLAGGLMTF
SKAYTLNDLPSYDHLQPGPGFARIDQILRELLDTVISTRFFAISLTQPKPAFYAGHLDSEKINSETAFYL
SITAAHPQSEIIESIPFRIKLGAPDDVEKLVLSAMSGVRLTHAAQVPAAIPVRPGACYFALDAHGPLYER
MLKAQSIMIYAPESYRDLTIELIAVTP
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|71905642|ref|NC_007298.1|:2353386-2354729 Dechloromonas aromatica RCB, complete genome
ATGAACAACGCAAAAATTCTCTGGGGTGAAGGGCTTTTTCTTCGTCCACAGCATTTCCAACAGCAGGACA
TCCAAACCGACGCCATGAACCGGCGCACCTTGCTCTCGGCCAACCCCTTCGCCTGGGGCATGCGCGACCT
GGATCTCGATCTCGATTCGCTGAAAAACGGGGTACTGCGCTTCAACCGCATTGATGCAGTTTTTGCCAAT
GGAAATTTTTTCACGGCTCCCGATATTGACCAGTTACCCGCCCCTCTGGCTCTGGATGCTGCCGTCGACG
AAGACGGAGCTACCGAGTTCTTTCTGGCGCTGCATCACCTGAACGCCCATGGCGGCAACTGTGCTGAAGA
CGTTTCCGACTCGGGCCAGGCTCGTTATCTGATCGTTCCCCGCGACAGGGCCGATCTTTATACCGAGGCA
GCCGAAGCCGACATCGCCACGCTCAGCCAAATTTCGCACCTTAAATCCGCCAACGAGAATCGCGACCAGT
TCCTGACGCTGCCTGTCGCACGAATTCGCCGCACTTCCAGCAACGGTTTTGAAGTTGATCCCTCTTTTGT
TCCGCCGTCGATCAGCCTGCGTAGCGCCCCCAATCTATACACGCTGCTCCGCCGGCAGATTGATGCCCTT
CTTGCCAAGGTAGATGCGCTTTATGGCTTTCATCGAGAGCCATCAAAAAACGTGATCGAATTCCGCTCCG
GCGACATTGCCTCCTTCTGGCTGCTCCACACGGCGAGTAGTGCCTGCGCCACGCTGACCCACCTGTTCCG
CAACCCGGACACCTCACCGGAACGACTATTCCAGGAATTGCTGCGCCTGGCCGGTGGACTGATGACCTTT
TCCAAGGCGTATACCCTGAACGACCTGCCCAGCTACGACCACCTGCAGCCCGGCCCTGGCTTTGCCCGTA
TCGACCAGATTTTGCGCGAATTGCTCGACACCGTGATTTCCACCCGTTTCTTCGCGATTTCTCTGACTCA
GCCCAAGCCGGCGTTCTACGCCGGCCATCTGGATTCCGAAAAGATCAATAGCGAAACAGCTTTTTACCTT
TCGATCACGGCAGCGCATCCACAGTCCGAAATCATCGAGTCGATTCCTTTCCGCATCAAGCTGGGCGCCC
CGGACGATGTCGAAAAACTCGTACTCTCCGCCATGTCCGGCGTTCGCCTGACCCATGCCGCCCAAGTTCC
AGCCGCCATTCCGGTTCGTCCCGGCGCCTGCTATTTCGCACTGGATGCCCACGGCCCGCTTTACGAACGA
ATGCTCAAAGCCCAATCCATCATGATTTACGCCCCGGAAAGTTACCGGGATCTCACCATTGAATTGATTG
CCGTTACGCCATGA